SitesBLAST
Comparing Ac3H11_209 FitnessBrowser__acidovorax_3H11:Ac3H11_209 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
34% identity, 98% coverage: 1:323/328 of query aligns to 1:330/334 of P0DPQ8
Sites not aligning to the query:
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
34% identity, 96% coverage: 9:323/328 of query aligns to 8:329/333 of 5ogxA
- binding flavin-adenine dinucleotide: Y132 (= Y131), R144 (= R142), Q145 (≠ P143), Y146 (= Y144), S147 (= S145), H161 (= H158), V162 (≠ I159), V165 (≠ M162), G168 (= G165), V169 (vs. gap), A170 (≠ R166), T171 (≠ V167), T214 (= T207), F329 (= F323)
- binding fe2/s2 (inorganic) cluster: C34 (= C35), N35 (≠ L36), G37 (= G38), C39 (= C40), G40 (= G41), C42 (= C43), C74 (= C73)
Sites not aligning to the query:
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
32% identity, 96% coverage: 8:323/328 of query aligns to 13:334/337 of 1krhA
- active site: C306 (= C295)
- binding flavin-adenine dinucleotide: Y143 (= Y131), R155 (= R142), S156 (≠ P143), Y157 (= Y144), S158 (= S145), V171 (≠ H158), V172 (≠ I159), G178 (= G165), K179 (≠ R166), M180 (≠ V167), S181 (= S168), T219 (= T207), E332 (= E321), F334 (= F323)
- binding fe2/s2 (inorganic) cluster: M38 (≠ Y33), D39 (≠ S34), C40 (= C35), R41 (≠ L36), G43 (= G38), C45 (= C40), G46 (= G41), C48 (= C43), C82 (= C73)
Sites not aligning to the query:
7c3bC Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
29% identity, 93% coverage: 19:324/328 of query aligns to 24:334/334 of 7c3bC
7c3aA Ferredoxin reductase in carbazole 1,9a-dioxygenase (see paper)
29% identity, 93% coverage: 19:324/328 of query aligns to 23:321/321 of 7c3aA
- binding flavin-adenine dinucleotide: C39 (= C35), S41 (= S37), W60 (vs. gap), R152 (= R142), A153 (≠ P143), Y154 (= Y144), S155 (= S145), Y169 (≠ H158), I170 (= I159), G176 (= G165), R177 (= R166), F178 (≠ V167), S179 (= S168), A218 (≠ T207), F320 (= F323), F321 (≠ Y324)
- binding fe2/s2 (inorganic) cluster: Y37 (= Y33), C39 (= C35), A40 (≠ L36), G42 (= G38), C44 (= C40), G45 (= G41), C47 (= C43), C80 (= C73)
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
32% identity, 70% coverage: 100:327/328 of query aligns to 12:248/250 of 1tvcA
- active site: Y63 (= Y144), S64 (= S145), L215 (= L294)
- binding dihydroflavine-adenine dinucleotide: N24 (≠ D112), F49 (≠ Y131), R61 (= R142), S62 (≠ P143), Y63 (= Y144), S64 (= S145), L78 (≠ H158), I79 (= I159), R80 (≠ Q160), L82 (≠ M162), F87 (≠ V167), G128 (= G208), N155 (≠ R235), E159 (= E239), S186 (≠ A266), G187 (≠ D267), E242 (= E321), F244 (= F323), L245 (≠ Y324)
4wqmA Structure of the toluene 4-monooxygenase nadh oxidoreductase t4mof, k270s k271s variant (see paper)
27% identity, 95% coverage: 12:324/328 of query aligns to 13:326/326 of 4wqmA
- binding flavin-adenine dinucleotide: C36 (= C35), S38 (= S37), W57 (vs. gap), Y135 (= Y131), R146 (= R142), A147 (≠ P143), Y148 (= Y144), S149 (= S145), I162 (≠ H158), V163 (≠ I159), G169 (= G165), K170 (≠ R166), V171 (= V167), S172 (= S168), S209 (≠ T207), F325 (= F323)
- binding fe2/s2 (inorganic) cluster: Y34 (= Y33), C36 (= C35), N37 (≠ L36), G39 (= G38), C41 (= C40), G42 (= G41), C44 (= C43), C76 (= C73)
Q03304 Toluene-4-monooxygenase system, ferredoxin--NAD(+) reductase component; T4MO; Ferredoxin--NAD(+) reductase; Toluene-4-monooxygenase systme, electron transfer component; EC 1.18.1.3 from Pseudomonas mendocina (see paper)
27% identity, 95% coverage: 12:324/328 of query aligns to 13:326/326 of Q03304
7c3bB Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
28% identity, 93% coverage: 19:324/328 of query aligns to 23:306/306 of 7c3bB
7qu3A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
27% identity, 56% coverage: 139:323/328 of query aligns to 80:278/279 of 7qu3A
- binding flavin-adenine dinucleotide: R83 (= R142), A84 (≠ P143), Y85 (= Y144), S86 (= S145), N100 (≠ H158), A104 (vs. gap), S105 (vs. gap), L112 (≠ M162), P113 (= P163), G115 (= G165), Q116 (≠ R166), M117 (≠ V167), S118 (= S168), A155 (≠ T207), F278 (= F323)
- binding 4-(benzimidazol-1-ylmethyl)benzenecarbonitrile: R102 (≠ Q160), G154 (= G206), G182 (= G233), F226 (≠ L275), I227 (≠ V276), P252 (≠ S297), M255 (= M300)
Sites not aligning to the query:
7qu5A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
27% identity, 56% coverage: 139:323/328 of query aligns to 80:278/280 of 7qu5A
- binding flavin-adenine dinucleotide: R83 (= R142), A84 (≠ P143), Y85 (= Y144), S86 (= S145), N100 (≠ H158), A104 (vs. gap), L112 (≠ M162), P113 (= P163), G115 (= G165), Q116 (≠ R166), M117 (≠ V167), S118 (= S168), A155 (≠ T207), F278 (= F323)
- binding gamma-Valerolactone: S105 (vs. gap), P108 (vs. gap), D196 (= D247), W207 (≠ V258), H208 (= H259), L209 (≠ V260)
Sites not aligning to the query:
8a1yF Sodium pumping nadh-quinone oxidoreductase with inhibitor hqno (see paper)
24% identity, 96% coverage: 10:323/328 of query aligns to 45:406/408 of 8a1yF
- binding flavin-adenine dinucleotide: R210 (= R142), A211 (≠ P143), Y212 (= Y144), S213 (= S145), V228 (≠ I159), R229 (≠ Q160), A231 (vs. gap), V240 (≠ M162), P241 (= P163), G243 (= G165), Q244 (≠ R166), M245 (≠ V167)
- binding fe2/s2 (inorganic) cluster: C70 (= C35), G74 (≠ R39), C76 (≠ G41), G77 (≠ I42), C79 (vs. gap), C111 (= C73)
A5F5Y4 Na(+)-translocating NADH-quinone reductase subunit F; Na(+)-NQR subunit F; Na(+)-translocating NQR subunit F; NQR complex subunit F; NQR-1 subunit F; EC 7.2.1.1 from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) (see paper)
24% identity, 96% coverage: 10:323/328 of query aligns to 45:406/408 of A5F5Y4
- C70 (= C35) binding ; mutation to A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
- C76 (≠ G41) binding ; mutation to A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
- C79 (vs. gap) binding ; mutation to A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
- C111 (= C73) binding ; mutation to A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
- R210 (= R142) mutation to L: Decreases flavin content, but does not affect the 2Fe-2S center. Exhibits very low NADH:quinone oxidoreductase activity.
- Y212 (= Y144) mutation to L: Decreases flavin content, but does not affect the 2Fe-2S center. Exhibits very low NADH:quinone oxidoreductase activity.
- S246 (= S168) mutation to A: Decreases flavin content, but does not affect the 2Fe-2S center. Exhibits very low NADH:quinone oxidoreductase activity.
8a1uF Sodium pumping nadh-quinone oxidoreductase with substrates nadh and q2 (see paper)
24% identity, 96% coverage: 10:323/328 of query aligns to 44:405/405 of 8a1uF
- binding flavin-adenine dinucleotide: Y166 (= Y131), R209 (= R142), A210 (≠ P143), Y211 (= Y144), S212 (= S145), A230 (vs. gap), P233 (vs. gap), V239 (≠ M162), P240 (= P163), G242 (= G165), Q243 (≠ R166), M244 (≠ V167), A282 (≠ T207), F405 (= F323)
- binding fe2/s2 (inorganic) cluster: C69 (= C35), G71 (≠ S37), G73 (≠ R39), C75 (≠ G41), G76 (≠ I42), C78 (vs. gap), C110 (= C73)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S212 (= S145), R228 (≠ Q160), G281 (= G206), A282 (≠ T207), G309 (= G233), R311 (= R235), S339 (≠ A263), F353 (≠ L275), C377 (= C295), G378 (= G296), P379 (= P298), M381 (= M300), M382 (≠ V301), D403 (≠ E321)
7qu0A X-ray structure of fad domain of nqrf of klebsiella pneumoniae (see paper)
26% identity, 56% coverage: 141:323/328 of query aligns to 82:279/279 of 7qu0A
- binding ~{N}-[2,6-bis(fluoranyl)phenyl]ethanamide: S213 (≠ A263), F227 (≠ L275), M256 (= M300)
- binding flavin-adenine dinucleotide: R83 (= R142), A84 (≠ P143), Y85 (= Y144), S86 (= S145), A104 (vs. gap), T105 (vs. gap), P106 (vs. gap), P107 (vs. gap), A113 (≠ M162), P114 (= P163), P115 (≠ Q164), G116 (= G165), I117 (≠ R166), M118 (≠ V167), S119 (= S168), F279 (= F323)
Sites not aligning to the query:
7qtyA X-ray structure of fad domain of nqrf of klebsiella pneumoniae (see paper)
26% identity, 56% coverage: 141:323/328 of query aligns to 82:279/279 of 7qtyA
- binding 1-(furan-2-ylmethyl)-3-(2-methylphenyl)thiourea: A184 (≠ L234), R185 (= R235), S213 (≠ A263), F227 (≠ L275), H229 (≠ T277), V255 (≠ P299), M256 (= M300)
- binding flavin-adenine dinucleotide: R83 (= R142), A84 (≠ P143), Y85 (= Y144), S86 (= S145), N100 (≠ H158), A104 (vs. gap), T105 (vs. gap), P107 (vs. gap), A113 (≠ M162), P114 (= P163), G116 (= G165), I117 (≠ R166), M118 (≠ V167), S119 (= S168), F279 (= F323)
Sites not aligning to the query:
4u9uA Crystal structure of nqrf fad-binding domain from vibrio cholerae (see paper)
25% identity, 56% coverage: 141:323/328 of query aligns to 80:277/279 of 4u9uA
- binding flavin-adenine dinucleotide: R81 (= R142), A82 (≠ P143), Y83 (= Y144), S84 (= S145), N98 (≠ H158), A102 (vs. gap), T103 (vs. gap), P104 (vs. gap), V111 (≠ M162), P112 (= P163), G114 (= G165), Q115 (≠ R166), M116 (≠ V167), S117 (= S168), F277 (= F323)
- binding magnesium ion: R186 (= R238), M188 (≠ L240)
- binding sodium ion: A198 (≠ R250), N201 (≠ H253), D202 (≠ P254), F204 (≠ L256)
Sites not aligning to the query:
2r6hC Crystal structure of the domain comprising the NAD binding and the fad binding regions of the nadh:ubiquinone oxidoreductase, na translocating, f subunit from porphyromonas gingivalis
26% identity, 56% coverage: 141:323/328 of query aligns to 85:288/289 of 2r6hC
- active site: C260 (= C295)
- binding flavin-adenine dinucleotide: R86 (= R142), A87 (≠ P143), Y88 (= Y144), S89 (= S145), N103 (≠ H158), A107 (vs. gap), T108 (vs. gap), I122 (≠ M162), K123 (≠ P163), P124 (≠ Q164), G125 (= G165), I126 (≠ R166), S127 (≠ V167), S128 (= S168), F288 (= F323)
Sites not aligning to the query:
6l2uA Soluble methane monooxygenase reductase fad-binding domain from methylosinus sporium. (see paper)
36% identity, 27% coverage: 101:189/328 of query aligns to 6:102/103 of 6l2uA
- binding flavin-adenine dinucleotide: F43 (≠ Y131), R55 (vs. gap), S56 (≠ P143), Y57 (= Y144), S58 (= S145), F71 (≠ H158), F71 (≠ H158), I72 (= I159), R73 (≠ Q160), L75 (≠ M162), P76 (= P163), P76 (= P163), G78 (= G165), A79 (≠ R166), F80 (≠ V167), S81 (= S168)
7romA Crystal structure of saccharomyces cerevisiae nadh-cytochrome b5 reductase 1 (cbr1) fragment (residues 28-284) bound to fad
25% identity, 53% coverage: 129:301/328 of query aligns to 56:227/255 of 7romA
- binding flavin-adenine dinucleotide: R61 (≠ L134), S62 (≠ G135), Y63 (≠ F136), T64 (= T137), L79 (≠ H158), V80 (≠ I159), Y83 (≠ M162), T85 (≠ Q164), G86 (= G165), N87 (≠ R166), V88 (= V167), S89 (= S168), T127 (= T207), A130 (= A210)
Query Sequence
>Ac3H11_209 FitnessBrowser__acidovorax_3H11:Ac3H11_209
MDILVQPLNRVIRAEPGVNLLDALRAAQVPMSYSCLSGRCGICRCRVLSGEVLDGGREQQ
RPLDGVDGAVLACQTYVTEPCTIEVPAPGEAVVHRARVAKATVVAIEPLAADIRRLLLKV
AKPIAYSPGQYMQLGFTPTHVRPYSMANLPGEPLLEFHIQLMPQGRVSGYIAGQLKVGDK
VKVSGPLGAAYLRQQHTGPMLCVAGGTGLASVLSVVRGAMAAGMRNPIHLYFGLRSPREL
YGLTWLDHLRSVHPALQVHVVVASRADSATQRRGLVTQAIEQDHASLQGWQAYLCGSPPM
VETTTLLALGKGLEAAHLHAEAFYMQGD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory