Comparing Ac3H11_210 FitnessBrowser__acidovorax_3H11:Ac3H11_210 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2v6kA Structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione (see paper)
74% identity, 100% coverage: 1:212/212 of query aligns to 3:214/214 of 2v6kA
2jl4A Holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class (see paper)
74% identity, 100% coverage: 1:212/212 of query aligns to 1:212/212 of 2jl4A
O86043 Maleylpyruvate isomerase; MPI; Naphthalene degradation protein L; EC 5.2.1.4 from Ralstonia sp. (see paper)
74% identity, 100% coverage: 1:212/212 of query aligns to 1:212/212 of O86043
4kdyA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound gsh in the active site
46% identity, 100% coverage: 1:211/212 of query aligns to 10:214/222 of 4kdyA
4kaeA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound dicarboxyethyl glutathione and citrate in the active site
46% identity, 100% coverage: 1:211/212 of query aligns to 8:212/220 of 4kaeA
O43708 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Homo sapiens (Human) (see 10 papers)
41% identity, 99% coverage: 3:211/212 of query aligns to 8:210/216 of O43708
1fw1A Glutathione transferase zeta/maleylacetoacetate isomerase (see paper)
40% identity, 99% coverage: 3:211/212 of query aligns to 4:206/208 of 1fw1A
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
39% identity, 99% coverage: 3:211/212 of query aligns to 8:210/216 of Q9WVL0
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
39% identity, 99% coverage: 3:211/212 of query aligns to 5:207/212 of 2cz2A
D2YW48 Probable glutathione S-transferase; EC 2.5.1.18 from Coccidioides immitis (strain RS) (Valley fever fungus)
37% identity, 99% coverage: 3:211/212 of query aligns to 8:225/231 of D2YW48
3n5oA Crystal structure of putative glutathione transferase from coccidioides immitis bound to glutathione (see paper)
36% identity, 100% coverage: 1:211/212 of query aligns to 4:223/228 of 3n5oA
4pxoA Crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068)
35% identity, 100% coverage: 1:211/212 of query aligns to 3:214/216 of 4pxoA
4xt0A Crystal structure of beta-etherase ligf from sphingobium sp. Strain syk-6 (see paper)
38% identity, 47% coverage: 1:99/212 of query aligns to 3:103/243 of 4xt0A
Sites not aligning to the query:
7dweA Crystal structure of a glutathione s-transferase sbgstu7 from salix babylonica in complex with glutathione
37% identity, 44% coverage: 1:93/212 of query aligns to 3:93/212 of 7dweA
2gdrA Crystal structure of a bacterial glutathione transferase (see paper)
23% identity, 96% coverage: 1:203/212 of query aligns to 1:194/202 of 2gdrA
3ublA Crystal structure of glutathione transferase (target efi-501770) from leptospira interrogans with gsh bound
29% identity, 77% coverage: 1:164/212 of query aligns to 3:152/212 of 3ublA
3m3mA Crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
28% identity, 89% coverage: 2:189/212 of query aligns to 4:185/201 of 3m3mA
4jbbA Crystal structure of glutathione s-transferase a6tby7(target efi- 507184) from klebsiella pneumoniae mgh 78578, gsh complex
34% identity, 49% coverage: 7:110/212 of query aligns to 12:118/208 of 4jbbA
4pngB Glutathione s-transferase from drosophila melanogaster - isozyme e7 (see paper)
29% identity, 83% coverage: 15:189/212 of query aligns to 18:187/223 of 4pngB
Sites not aligning to the query:
7rkaA Crystal structure analysis of colorado potato beetle glutathione-s transferase ldgstu1 (see paper)
27% identity, 95% coverage: 1:201/212 of query aligns to 2:211/211 of 7rkaA
>Ac3H11_210 FitnessBrowser__acidovorax_3H11:Ac3H11_210
MRLYSFFRSGTSHRLRIALNLKGLAYEQVAVDLRREEHLGDAFKAINPQQFVPVLEADER
LMIQSPAIIEWLEERYPTPPLLPGDAGDRAQVRALAAIVGCDIHPINNRRILEALRHRFG
ADEAAVNDWCGTWISAGFDAIEALLSKDPQRGDFCFGSTPTLADVYLVPQVESARRFKVD
LARWPLVQAVDAACAQLEAFRKAAPSAQPDAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory