SitesBLAST
Comparing Ac3H11_214 FitnessBrowser__acidovorax_3H11:Ac3H11_214 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
40% identity, 95% coverage: 21:431/431 of query aligns to 2:411/422 of P16640
- A15 (= A34) binding
- D37 (= D56) binding
- K50 (= K69) binding
- V83 (= V102) binding
- R134 (= R150) binding
- D284 (= D304) binding
- V302 (≠ W322) binding
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
40% identity, 95% coverage: 21:431/431 of query aligns to 1:410/422 of 1q1wA
- active site: L13 (≠ Q33), L44 (≠ R64), P45 (= P65), L305 (≠ Q326)
- binding flavin-adenine dinucleotide: G10 (= G30), G12 (= G32), L13 (≠ Q33), A14 (= A34), G35 (= G55), D36 (= D56), L44 (≠ R64), P45 (= P65), K49 (= K69), V82 (= V102), A108 (≠ C128), T109 (= T129), G110 (= G130), R133 (= R150), I159 (= I176), D283 (= D304), S300 (= S321), V301 (≠ W322), W329 (= W350)
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
42% identity, 94% coverage: 25:430/431 of query aligns to 3:401/404 of 3fg2P
- binding flavin-adenine dinucleotide: G8 (= G30), G10 (= G32), H11 (≠ Q33), A12 (= A34), D34 (= D56), E35 (= E57), R42 (= R64), P43 (= P65), S46 (= S68), K47 (= K69), R78 (≠ M100), M79 (≠ Q101), T106 (= T129), R127 (= R150), I153 (= I176), D275 (= D304), S292 (= S321), V293 (≠ W322), W321 (= W350)
8pxkA Structure of nadh-dependent ferredoxin reductase, bpha4, solved at wavelength 5.76 a (see paper)
41% identity, 94% coverage: 26:431/431 of query aligns to 7:399/403 of 8pxkA
- binding flavin-adenine dinucleotide: G13 (= G32), A15 (= A34), D37 (= D56), E38 (= E57), R45 (= R64), P46 (= P65), K50 (= K69), A79 (≠ V102), T106 (= T129), G107 (= G130), R127 (= R150), I153 (= I176), G269 (= G303), D270 (= D304), E286 (= E320), T287 (≠ S321), W288 (= W322), A291 (= A325), W317 (= W350)
2yvjA Crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex (see paper)
41% identity, 94% coverage: 26:431/431 of query aligns to 6:398/402 of 2yvjA
- active site: L13 (≠ Q33), R44 (= R64), P45 (= P65), Q291 (= Q326)
- binding flavin-adenine dinucleotide: G10 (= G30), G12 (= G32), G35 (= G55), D36 (= D56), E37 (= E57), R44 (= R64), P45 (= P65), A78 (≠ V102), T105 (= T129), G106 (= G130), R126 (= R150), G268 (= G303), D269 (= D304), T286 (≠ S321), W287 (= W322), A290 (= A325), W316 (= W350)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V147 (= V171), G148 (= G172), G149 (= G173), G150 (= G174), I152 (= I176), V170 (= V194), E171 (= E195), T172 (= T196), R179 (= R203), G230 (= G265), I231 (≠ V266), G232 (= G267), V233 (≠ L268), E285 (= E320)
1f3pA Ferredoxin reductase (bpha4)-nadh complex (see paper)
41% identity, 94% coverage: 26:431/431 of query aligns to 6:398/401 of 1f3pA
- active site: L13 (≠ Q33), R44 (= R64), P45 (= P65), Q291 (= Q326)
- binding flavin-adenine dinucleotide: A14 (= A34), V34 (≠ I54), D36 (= D56), E37 (= E57), R44 (= R64), P45 (= P65), A78 (≠ V102), T105 (= T129), G106 (= G130), R126 (= R150), G268 (= G303), D269 (= D304), E285 (= E320), T286 (≠ S321), W287 (= W322), A290 (= A325), W316 (= W350)
- binding nicotinamide-adenine-dinucleotide: V147 (= V171), G148 (= G172), G150 (= G174), V151 (≠ W175), I152 (= I176), E155 (= E179), E171 (= E195), T172 (= T196), R179 (= R203), G230 (= G265), I231 (≠ V266), G232 (= G267), V233 (≠ L268), E285 (= E320), W316 (= W350), S317 (= S351)
2gr2A Crystal structure of ferredoxin reductase, bpha4 (oxidized form)
41% identity, 94% coverage: 26:431/431 of query aligns to 5:397/401 of 2gr2A
- active site: L12 (≠ Q33), R43 (= R64), P44 (= P65), Q290 (= Q326)
- binding adenosine-5-diphosphoribose: R109 (= R134), V146 (= V171), G147 (= G172), G149 (= G174), V150 (≠ W175), I151 (= I176), E170 (= E195), T171 (= T196), R178 (= R203), G229 (= G265), I230 (≠ V266), G231 (= G267), E284 (= E320)
- binding flavin-adenine dinucleotide: G11 (= G32), A13 (= A34), D35 (= D56), E36 (= E57), R43 (= R64), P44 (= P65), K48 (= K69), A77 (≠ V102), T104 (= T129), G105 (= G130), R125 (= R150), G267 (= G303), D268 (= D304), T285 (≠ S321), W286 (= W322), A289 (= A325), W315 (= W350)
2gr0A Crystal structure of ferredoxin reductase, bpha4 (oxidized form, NAD+ complex) (see paper)
41% identity, 94% coverage: 26:431/431 of query aligns to 5:397/401 of 2gr0A
- active site: L12 (≠ Q33), R43 (= R64), P44 (= P65), Q290 (= Q326)
- binding adenosine-5'-diphosphate: V146 (= V171), G147 (= G172), G149 (= G174), I151 (= I176), E170 (= E195), T171 (= T196), R178 (= R203), G229 (= G265), I230 (≠ V266), G231 (= G267)
- binding flavin-adenine dinucleotide: G11 (= G32), A13 (= A34), D35 (= D56), E36 (= E57), R43 (= R64), P44 (= P65), K48 (= K69), T76 (≠ Q101), A77 (≠ V102), T104 (= T129), G105 (= G130), R125 (= R150), I151 (= I176), G267 (= G303), D268 (= D304), E284 (= E320), T285 (≠ S321), W286 (= W322), A289 (= A325), W315 (= W350)
4h4uA Crystal structure of ferredoxin reductase, bpha4 t176r mutant (reduced form)
41% identity, 94% coverage: 26:431/431 of query aligns to 6:398/401 of 4h4uA
- active site: L13 (≠ Q33), R44 (= R64), P45 (= P65), Q291 (= Q326)
- binding flavin-adenine dinucleotide: G12 (= G32), A14 (= A34), D36 (= D56), R44 (= R64), P45 (= P65), A78 (≠ V102), T105 (= T129), G106 (= G130), L125 (= L149), R126 (= R150), I152 (= I176), E155 (= E179), G268 (= G303), D269 (= D304), E285 (= E320), T286 (≠ S321), W287 (= W322), A290 (= A325), W316 (= W350)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V151 (≠ W175), I152 (= I176), E171 (= E195), R172 (≠ T196), Q173 (= Q197), G230 (= G265), I231 (≠ V266), G232 (= G267), I284 (≠ L319), E285 (= E320), Y315 (≠ F349)
4h4wA Crystal structure of ferredoxin reductase, bpha4 e175c/t176r/q177g mutant (reduced form)
40% identity, 94% coverage: 26:431/431 of query aligns to 5:397/399 of 4h4wA
- active site: L12 (≠ Q33), R43 (= R64), P44 (= P65), Q290 (= Q326)
- binding flavin-adenine dinucleotide: G11 (= G32), A13 (= A34), D35 (= D56), R43 (= R64), P44 (= P65), A77 (≠ V102), T104 (= T129), G105 (= G130), R125 (= R150), I151 (= I176), E154 (= E179), G267 (= G303), D268 (= D304), T285 (≠ S321), W286 (= W322), A289 (= A325), W315 (= W350)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G148 (= G173), I151 (= I176), R171 (≠ T196), S177 (≠ E202), R178 (= R203), G229 (= G265), I230 (≠ V266), G231 (= G267)
3lxdA Crystal structure of ferredoxin reductase arr from novosphingobium aromaticivorans (see paper)
40% identity, 94% coverage: 26:431/431 of query aligns to 6:407/409 of 3lxdA
- active site: H13 (≠ Q33), R44 (= R64), P45 (= P65), N302 (≠ Q326)
- binding flavin-adenine dinucleotide: V9 (= V29), G10 (= G30), G12 (= G32), H13 (≠ Q33), G14 (≠ A34), R36 (≠ D56), E37 (= E57), R44 (= R64), P45 (= P65), S48 (= S68), K49 (= K69), E81 (≠ Q101), V82 (= V102), T109 (= T129), I157 (= I176), G278 (= G303), D279 (= D304), S297 (= S321), V298 (≠ W322), F325 (= F349), W326 (= W350)
4emjA Complex between the reductase and ferredoxin components of toluene dioxygenase (see paper)
39% identity, 94% coverage: 23:428/431 of query aligns to 2:398/406 of 4emjA
- binding flavin-adenine dinucleotide: G11 (= G32), V12 (≠ Q33), G13 (≠ A34), D35 (= D56), E36 (= E57), R43 (= R64), P44 (= P65), S47 (= S68), K48 (= K69), V80 (= V102), T107 (= T129), G108 (= G130), R128 (= R150), G274 (= G303), D275 (= D304), T291 (≠ S321), Y292 (≠ W322), S319 (≠ F349), W320 (= W350)
4emiA Toluene dioxygenase reductase in reduced state in complex with NAD+ (see paper)
39% identity, 94% coverage: 23:428/431 of query aligns to 1:397/402 of 4emiA
- binding flavin-adenine dinucleotide: G10 (= G32), V11 (≠ Q33), G12 (≠ A34), D34 (= D56), E35 (= E57), R42 (= R64), P43 (= P65), K47 (= K69), E78 (≠ Q101), V79 (= V102), T106 (= T129), G107 (= G130), G273 (= G303), D274 (= D304), T290 (≠ S321), Y291 (≠ W322), W319 (= W350)
- binding nicotinamide-adenine-dinucleotide: R111 (= R134), G149 (= G172), L152 (≠ W175), I153 (= I176), E156 (= E179), E172 (= E195), A173 (≠ T196), R180 (= R203), V236 (= V266), G237 (= G267), A238 (≠ L268), E289 (= E320), W319 (= W350), T320 (≠ S351)
6tukB Crystal structure of fdr9 (see paper)
35% identity, 81% coverage: 26:375/431 of query aligns to 4:337/393 of 6tukB
- binding flavin-adenine dinucleotide: V7 (= V29), G8 (= G30), G9 (≠ A31), G10 (= G32), A12 (= A34), A34 (≠ D56), E35 (= E57), R42 (= R64), P43 (= P65), K47 (= K69), A75 (≠ Q101), A76 (≠ V102), T102 (= T129), G103 (= G130), V118 (≠ L149), R119 (= R150), G259 (= G303), D260 (= D304), H277 (≠ S321), W278 (= W322), F311 (= F349), W312 (= W350)
Q9LFA3 Monodehydroascorbate reductase 1, peroxisomal; AtMDAR1; EC 1.6.5.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 80% coverage: 20:362/431 of query aligns to 2:360/434 of Q9LFA3
Sites not aligning to the query:
- 432:434 mutation Missing: Loss of peroxisomal targeting.
Q9LK94 Monodehydroascorbate reductase 4, peroxisomal; AtMDAR4; EC 1.6.5.4 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
29% identity, 74% coverage: 49:365/431 of query aligns to 31:359/488 of Q9LK94
Sites not aligning to the query:
- 11 G→Q: In sdp2-2; loss of ascorbate recycling.
- 14 V→A: In sdp2-1; loss of ascorbate recycling.
- 386 G→Q: In sdp2-3; loss of ascorbate recycling.
- 483:488 mutation Missing: Loss of peroxisomal targeting.
- 488 mutation Missing: No effect on peroxisomal targeting.
Q652L6 Monodehydroascorbate reductase 3, cytosolic; OsMDAR3; OsMDHAR3; EC 1.6.5.4 from Oryza sativa subsp. japonica (Rice) (see paper)
29% identity, 77% coverage: 49:378/431 of query aligns to 33:377/435 of Q652L6
- E41 (= E57) binding
- R48 (= R64) binding
- K53 (= K69) binding
- C70 (vs. gap) mutation to A: No effect on catalytic activity.; mutation to S: Slight reduction of catalytic activity.
- G72 (vs. gap) mutation to N: Slight reduction of catalytic activity.
- I96 (≠ V102) binding
- RE 147:148 (≠ RT 150:151) binding
- 172:178 (vs. 173:179, 86% identical) binding
- YIGLE 174:178 (≠ WIGLE 175:179) binding
- E196 (≠ Q197) binding ; mutation to A: Reduces catalytic activity 2-fold.
- R202 (= R203) binding ; binding
- G261 (= G267) binding ; binding
- D298 (= D304) binding
- EH 314:315 (≠ ES 320:321) binding ; binding
- V316 (≠ W322) binding
- R320 (≠ Q326) binding ; mutation to A: Reduces catalytic activity 5-fold.
- Y349 (≠ W350) binding ; binding ; binding ; mutation Y->A,F,W: Abolishes catalytic activity.
- R351 (≠ D352) binding ; mutation to A: No effect on catalytic activity.
Sites not aligning to the query:
5jciA Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. Japonica (see paper)
29% identity, 77% coverage: 49:378/431 of query aligns to 30:374/432 of 5jciA
- active site: R45 (= R64), P46 (= P65), L61 (vs. gap), H65 (vs. gap), S70 (vs. gap), R317 (≠ Q326)
- binding flavin-adenine dinucleotide: S36 (≠ G55), K37 (≠ D56), E38 (= E57), R45 (= R64), P46 (= P65), K50 (= K69), I93 (≠ V102), A119 (≠ C128), T120 (= T129), G121 (= G130), R144 (= R150), E145 (≠ T151), Y171 (≠ W175), I172 (= I176), L262 (≠ N271), D295 (= D304), H312 (≠ S321), V313 (≠ W322), A316 (= A325), F345 (= F349), Y346 (≠ W350)
Sites not aligning to the query:
5jcnA Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. Japonica (see paper)
29% identity, 77% coverage: 49:378/431 of query aligns to 30:374/429 of 5jcnA
- active site: R45 (= R64), P46 (= P65), L61 (vs. gap), H65 (vs. gap), S70 (vs. gap), R317 (≠ Q326)
- binding ascorbic acid: P46 (= P65), G69 (vs. gap), R317 (≠ Q326), F346 (≠ W350)
- binding flavin-adenine dinucleotide: K37 (≠ D56), E38 (= E57), R45 (= R64), P46 (= P65), K50 (= K69), I93 (≠ V102), A119 (≠ C128), T120 (= T129), R144 (= R150), E145 (≠ T151), L262 (≠ N271), D295 (= D304), E311 (= E320), H312 (≠ S321), V313 (≠ W322), F346 (≠ W350)
- binding nicotinamide-adenine-dinucleotide: G170 (= G174), Y171 (≠ W175), I172 (= I176), P192 (≠ T196), G256 (= G265), V257 (= V266), G258 (= G267), E311 (= E320), H312 (≠ S321), F346 (≠ W350)
Sites not aligning to the query:
5jcmA Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. Japonica (see paper)
29% identity, 77% coverage: 49:378/431 of query aligns to 30:374/429 of 5jcmA
- active site: R45 (= R64), P46 (= P65), L61 (vs. gap), H65 (vs. gap), S70 (vs. gap), R317 (≠ Q326)
- binding flavin-adenine dinucleotide: S36 (≠ G55), K37 (≠ D56), E38 (= E57), R45 (= R64), P46 (= P65), K50 (= K69), I93 (≠ V102), A119 (≠ C128), T120 (= T129), G121 (= G130), R144 (= R150), E145 (≠ T151), D295 (= D304), E311 (= E320), H312 (≠ S321), V313 (≠ W322), A316 (= A325), F346 (≠ W350)
- binding isoascorbic acid: E44 (= E63), P46 (= P65), K50 (= K69), G69 (vs. gap), R317 (≠ Q326), F346 (≠ W350)
- binding nicotinamide-adenine-dinucleotide: G170 (= G174), Y171 (≠ W175), I172 (= I176), E175 (= E179), P192 (≠ T196), G256 (= G265), V257 (= V266), G258 (= G267), E311 (= E320), H312 (≠ S321), F346 (≠ W350)
Sites not aligning to the query:
Query Sequence
>Ac3H11_214 FitnessBrowser__acidovorax_3H11:Ac3H11_214
MTAERPEVEAAALPHEGANAHSAHTIVIVGAGQAGGWAAQALRSEGFAGRVVLIGDEAHP
PHERPPLSKAVLSGAAAPESTRLMKPEAFDALAVQWRPGMQVHRIDRAAKQVLLSDGTAQ
PYDKLILCTGGRARRLAVPGADQVPLHTLRTIEDAQALAPALRPGRSVVVVGGGWIGLEV
AATARQQGAEVVVVETQSRLCERSVPAEVSAYLLALHRAQGVRVLLGAGVRGFARAADGA
DGADSRSEVLLADGSALACDTIVLGVGLVPNDELARAAGLACDGGVRVDAQCRTSDPHIL
AAGDVAVAPNPWVGRSLRLESWQNAQEQGMAAARSALGQAVDYQPLPWFWSDQYGTNLQI
YGMPTPAHLVVPRGDPASGSFVLFYLAGDVVQAAVGANAARDLRFARRLIDQRKPVDAER
LADLGTPMAKL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory