Comparing Ac3H11_215 FitnessBrowser__acidovorax_3H11:Ac3H11_215 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
5bokA Ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. Strain ds2
65% identity, 97% coverage: 4:104/104 of query aligns to 2:102/102 of 5bokA
P0A185 Naphthalene 1,2-dioxygenase system, ferredoxin component from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
60% identity, 100% coverage: 1:104/104 of query aligns to 1:104/104 of P0A185
2qpzA Naphthalene 1,2-dioxygenase rieske ferredoxin (see paper)
59% identity, 99% coverage: 2:104/104 of query aligns to 1:103/103 of 2qpzA
2i7fA Sphingomonas yanoikuyae b1 ferredoxin (see paper)
50% identity, 73% coverage: 29:104/104 of query aligns to 27:100/102 of 2i7fA
1fqtA Crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase (see paper)
43% identity, 88% coverage: 13:104/104 of query aligns to 11:103/109 of 1fqtA
2e4pA Crystal structure of bpha3 (oxidized form) (see paper)
39% identity, 94% coverage: 4:101/104 of query aligns to 1:99/108 of 2e4pA
3dqyA Crystal structure of toluene 2,3-dioxygenase ferredoxin (see paper)
38% identity, 97% coverage: 4:104/104 of query aligns to 1:101/106 of 3dqyA
Q8GI16 Ferredoxin CarAc; Carbazole 1,9a-dioxygenase, ferredoxin component; CARDO from Pseudomonas resinovorans (see 2 papers)
37% identity, 98% coverage: 1:102/104 of query aligns to 1:103/107 of Q8GI16
4nbbE Carbazole- and oxygen-bound oxygenase with ile262 replaced by val and ferredoxin complex of carbazole 1,9a-dioxygenase (see paper)
37% identity, 94% coverage: 5:102/104 of query aligns to 4:102/114 of 4nbbE
3gceA Ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 (see paper)
42% identity, 76% coverage: 24:102/104 of query aligns to 22:102/104 of 3gceA
>Ac3H11_215 FitnessBrowser__acidovorax_3H11:Ac3H11_215
MTTNWIDAAAHGDVPEDDVIGLAVAGRDIALYGVGGEVFATDNICTHGHARLCDGFLEGH
EIECPLHQGKFDVRDGKPTCAPVTEPLRSYPVKIEGGRVWLALD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory