SitesBLAST
Comparing Ac3H11_217 FitnessBrowser__acidovorax_3H11:Ac3H11_217 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7c8zA Crystal structure of salicylate 5-hydroxylase naggh (a rieske non-heme iron-dependent monooxgenase) (see paper)
72% identity, 98% coverage: 8:437/441 of query aligns to 2:381/383 of 7c8zA
- active site: H106 (= H112), D213 (= D219), H216 (= H222), H221 (= H227), D330 (= D386)
- binding fe (iii) ion: H216 (= H222), H221 (= H227), D330 (= D386)
- binding fe2/s2 (inorganic) cluster: C83 (= C89), H85 (= H91), C103 (= C109), H106 (= H112), W108 (= W114)
7q05E Crystal structure of tpado in complex with tpa (see paper)
37% identity, 97% coverage: 13:440/441 of query aligns to 4:393/409 of 7q05E
- binding fe2/s2 (inorganic) cluster: C80 (= C89), H82 (= H91), R83 (= R92), C100 (= C109), Y102 (= Y111), H103 (= H112), W105 (= W114)
- binding terephthalic acid: V203 (≠ I217), A209 (≠ P223), S241 (≠ M255), L271 (= L286), I273 (= I288), R292 (= R339), D339 (= D386)
7q06D Crystal structure of tpado in complex with 2-oh-tpa (see paper)
37% identity, 97% coverage: 13:440/441 of query aligns to 4:388/389 of 7q06D
- binding 2-Hydroxyterephthalic acid: V203 (≠ I217), S206 (≠ P220), A209 (≠ P223), F216 (= F230), N222 (≠ W236), S241 (= S273), I268 (≠ M320), R287 (= R339)
- binding fe (iii) ion: H208 (= H222), H213 (= H227), D334 (= D386)
- binding fe2/s2 (inorganic) cluster: C80 (= C89), H82 (= H91), R83 (= R92), C100 (= C109), Y102 (= Y111), H103 (= H112), W105 (= W114)
7vjuA Crystal structure of terephthalate dioxygenase from comamonas testosteroni kf1 (see paper)
37% identity, 97% coverage: 13:440/441 of query aligns to 3:377/378 of 7vjuA
7q04D Crystal structure of tpado in a substrate-free state (see paper)
36% identity, 97% coverage: 13:440/441 of query aligns to 3:374/374 of 7q04D
5aeuA Crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 (see paper)
31% identity, 93% coverage: 28:437/441 of query aligns to 23:423/433 of 5aeuA
- active site: H106 (= H112), D204 (= D219), H207 (= H222), H213 (= H227), D362 (= D386)
- binding fe (ii) ion: H207 (= H222), H213 (= H227), D362 (= D386)
- binding fe2/s2 (inorganic) cluster: C83 (= C89), H85 (= H91), R86 (= R92), M88 (= M94), C103 (= C109), Y105 (= Y111), H106 (= H112), W108 (= W114)
2xshA Crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with 2,6 di chlorobiphenyl (see paper)
31% identity, 93% coverage: 28:437/441 of query aligns to 23:423/433 of 2xshA
- active site: H106 (= H112), D204 (= D219), H207 (= H222), H213 (= H227), D362 (= D386)
- binding 2,6-dichlorobiphenyl: F201 (≠ I217), M205 (≠ P220), H207 (= H222), Q296 (vs. gap), H297 (≠ M320), L307 (≠ Q330), F358 (≠ V382)
- binding fe (ii) ion: Q200 (≠ N216), H207 (= H222), H213 (= H227), D362 (= D386)
- binding fe2/s2 (inorganic) cluster: C83 (= C89), H85 (= H91), R86 (= R92), C103 (= C109), Y105 (= Y111), H106 (= H112), W108 (= W114)
Q53122 Biphenyl 2,3-dioxygenase subunit alpha; Biphenyl dioxygenase system, oxygenase component subunit alpha; BDO, oxygenase component subunit alpha; Rieske dioxygenase; Terminal oxygenase component of biphenyl dioxygenase, large subunit; EC 1.14.12.18 from Rhodococcus jostii (strain RHA1) (see paper)
31% identity, 95% coverage: 20:437/441 of query aligns to 30:439/460 of Q53122
- C98 (= C89) binding
- H100 (= H91) binding
- C118 (= C109) binding
- H121 (= H112) binding
- 217:230 (vs. 216:227, 36% identical) binding
- H224 (= H222) binding
- H230 (= H227) binding
- D378 (= D386) binding
2yflA Crystal structure of biphenyl dioxygenase variant rr41 with 2-chloro dibenzofuran (see paper)
31% identity, 93% coverage: 28:437/441 of query aligns to 23:423/433 of 2yflA
- active site: H106 (= H112), D204 (= D219), H207 (= H222), H213 (= H227), D362 (= D386)
- binding 2-chlorodibenzofuran: Q200 (≠ N216), D204 (= D219), M205 (≠ P220), H207 (= H222), S257 (= S273), H297 (≠ M320), L307 (≠ Q330), F352 (= F376)
- binding fe (ii) ion: Q200 (≠ N216), H207 (= H222), H213 (= H227), D362 (= D386)
- binding fe2/s2 (inorganic) cluster: C83 (= C89), H85 (= H91), R86 (= R92), C103 (= C109), Y105 (= Y111), H106 (= H112), W108 (= W114)
2yfjA Crystal structure of biphenyl dioxygenase variant rr41 with dibenzofuran (see paper)
31% identity, 93% coverage: 28:437/441 of query aligns to 23:423/433 of 2yfjA
- active site: H106 (= H112), D204 (= D219), H207 (= H222), H213 (= H227), D362 (= D386)
- binding dibenzofuran: Q200 (≠ N216), F201 (≠ I217), D204 (= D219), M205 (≠ P220), H207 (= H222), A208 (≠ P223), H297 (≠ M320), L307 (≠ Q330), F358 (≠ V382)
- binding fe (ii) ion: Q200 (≠ N216), H207 (= H222), H213 (= H227), D362 (= D386)
- binding fe2/s2 (inorganic) cluster: C83 (= C89), H85 (= H91), R86 (= R92), C103 (= C109), Y105 (= Y111), H106 (= H112), W108 (= W114)
1uljA Biphenyl dioxygenase (bpha1a2) in complex with the substrate (see paper)
31% identity, 95% coverage: 20:439/441 of query aligns to 14:415/425 of 1uljA
- active site: H105 (= H112), D205 (= D219), H208 (= H222), H214 (≠ N240), D352 (= D386)
- binding biphenyl: Q201 (≠ N216), F202 (≠ I217), D205 (= D219), M206 (≠ P220), H208 (= H222), A209 (≠ P223), H214 (≠ N240), I252 (vs. gap), H287 (≠ M320), L297 (≠ Q330), F342 (= F376)
- binding fe (ii) ion: Q201 (≠ N216), H208 (= H222), H214 (≠ N240), D352 (= D386)
- binding fe2/s2 (inorganic) cluster: C82 (= C89), H84 (= H91), R85 (= R92), M87 (= M94), C102 (= C109), Y104 (= Y111), H105 (= H112), W107 (= W114)
2xrxA Crystal structure of biphenyl dioxygenase in complex with biphenyl from burkholderia xenovorans lb400 (see paper)
31% identity, 93% coverage: 28:437/441 of query aligns to 23:422/432 of 2xrxA
- active site: H106 (= H112), D203 (= D219), H206 (= H222), H212 (= H227), D361 (= D386)
- binding biphenyl: Q199 (≠ N216), F200 (≠ I217), D203 (= D219), H206 (= H222), H296 (≠ M320), L306 (≠ Q330), F309 (≠ V333), F357 (≠ V382)
- binding fe (ii) ion: Q199 (≠ N216), H206 (= H222), H212 (= H227), D361 (= D386)
- binding fe2/s2 (inorganic) cluster: C83 (= C89), H85 (= H91), R86 (= R92), C103 (= C109), Y105 (= Y111), H106 (= H112), W108 (= W114)
1uliC Biphenyl dioxygenase (bpha1a2) derived from rhodococcus sp. Strain rha1 (see paper)
30% identity, 95% coverage: 20:437/441 of query aligns to 14:411/425 of 1uliC
- active site: H105 (= H112), D205 (= D219), H208 (= H222), H214 (≠ G260), D350 (= D386)
- binding fe (ii) ion: H208 (= H222), H214 (≠ G260), D350 (= D386)
- binding fe2/s2 (inorganic) cluster: C82 (= C89), H84 (= H91), R85 (= R92), C102 (= C109), Y104 (= Y111), H105 (= H112), W107 (= W114)
3gzxA Crystal structure of the biphenyl dioxygenase in complex with biphenyl from comamonas testosteroni sp. Strain b-356 (see paper)
30% identity, 97% coverage: 10:437/441 of query aligns to 4:430/440 of 3gzxA
- active site: H106 (= H112), D213 (= D219), H216 (= H222), H222 (= H227), D369 (= D386)
- binding biphenyl: Q209 (≠ N216), F210 (≠ I217), H216 (= H222), G302 (≠ A318), H304 (≠ M320), L314 (≠ Q330)
- binding fe (ii) ion: Q209 (≠ N216), H216 (= H222), H222 (= H227), D369 (= D386)
- binding fe2/s2 (inorganic) cluster: C83 (= C89), H85 (= H91), R86 (= R92), C103 (= C109), Y105 (= Y111), H106 (= H112), W108 (= W114)
1wqlA Cumene dioxygenase (cuma1a2) from pseudomonas fluorescens ip01 (see paper)
30% identity, 93% coverage: 28:437/441 of query aligns to 23:426/436 of 1wqlA
- active site: H106 (= H112), D208 (= D219), H211 (= H222), H217 (= H227), D365 (= D386)
- binding fe (ii) ion: H211 (= H222), H217 (= H227), D365 (= D386)
- binding fe2/s2 (inorganic) cluster: C83 (= C89), H85 (= H91), R86 (= R92), C103 (= C109), Y105 (= Y111), H106 (= H112), W108 (= W114)
- binding oxygen molecule: H211 (= H222), F355 (= F376)
3en1A Crystal structure of toluene 2,3-dioxygenase (see paper)
30% identity, 95% coverage: 22:439/441 of query aligns to 16:424/424 of 3en1A
- active site: H105 (= H112), D205 (= D219), H208 (= H222), H214 (≠ N240), D360 (= D386)
- binding fe (ii) ion: Q201 (≠ N216), H208 (= H222), H214 (≠ N240), D360 (= D386)
- binding fe2/s2 (inorganic) cluster: C82 (= C89), H84 (= H91), R85 (= R92), C102 (= C109), Y104 (= Y111), H105 (= H112), W107 (= W114)
- binding toluene: Q201 (≠ N216), F202 (≠ I217), D205 (= D219), H208 (= H222), H295 (≠ M320)
O85673 Anthranilate 1,2-dioxygenase large subunit; EC 1.14.12.1 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see 2 papers)
27% identity, 87% coverage: 17:400/441 of query aligns to 22:393/471 of O85673
- M43 (≠ L38) mutation to K: Prevents anthranilate degradation.
- D217 (= D219) mutation to A: In ACN476; loss of dioxygenase activity and 2-fold lower redox potential.; mutation to E: Loss of dioxygenase activity and lack of iron at the mononuclear site.; mutation to N: Loss of dioxygenase activity.
2b24A Crystal structure of naphthalene 1,2-dioxygenase from rhodococcus sp. Bound to indole (see paper)
32% identity, 52% coverage: 23:253/441 of query aligns to 23:245/440 of 2b24A
- active site: H111 (= H112), D213 (= D219), H216 (= H222), H221 (= H227)
- binding fe (iii) ion: H216 (= H222), H221 (= H227)
- binding fe2/s2 (inorganic) cluster: C88 (= C89), H90 (= H91), R91 (= R92), C108 (= C109), Y110 (= Y111), H111 (= H112), W113 (= W114)
- binding indole: D213 (= D219)
Sites not aligning to the query:
2b1xA Crystal structure of naphthalene 1,2-dioxygenase from rhodococcus sp. (see paper)
32% identity, 52% coverage: 23:253/441 of query aligns to 23:245/441 of 2b1xA
- active site: H111 (= H112), D213 (= D219), H216 (= H222), H221 (= H227)
- binding fe (iii) ion: H216 (= H222), H221 (= H227)
- binding fe2/s2 (inorganic) cluster: C88 (= C89), H90 (= H91), R91 (= R92), C108 (= C109), Y110 (= Y111), H111 (= H112), W113 (= W114)
Sites not aligning to the query:
4hm8A Naphthalene 1,2-dioxygenase bound to thioanisole
24% identity, 92% coverage: 30:434/441 of query aligns to 23:421/446 of 4hm8A
- active site: H104 (= H112), D205 (= D219), H208 (= H222), H213 (= H227), D362 (= D386)
- binding (methylsulfanyl)benzene: N201 (= N216), H295 (≠ A318)
- binding fe (iii) ion: H208 (= H222), H213 (= H227), D362 (= D386)
- binding fe2/s2 (inorganic) cluster: C81 (= C89), H83 (= H91), R84 (= R92), C101 (= C109), Y103 (= Y111), H104 (= H112), W106 (= W114)
Query Sequence
>Ac3H11_217 FitnessBrowser__acidovorax_3H11:Ac3H11_217
MHECPVTVFPQQIRWETDGTSRIPFQAYTDEALYRKELDRLFYNGHWCYVGLEAEIPNAG
DFKRTVIGERSVLLVRDKDASIHVVENVCAHRGMAFCRERHGNRESLTCPYHQWNYTLSG
DLQGVPFRRGVKQDGKVNGGMPADFNPAEHGLTKLKVATRGGVVFASFDHSVEPLEEFLG
PTILGYFDRLFNGRKLTILGYNRQRIPGNWKLMQENIKDPYHPGLLHTWFVTFGLWRADN
KSQLLMDAQHRHAAMVSTRGAAGKAADVTQVSSFKAGMELNDPRFLDIAQEGWWAGPAPA
ASGEGAAVPSAGAAVPTAVMMTVFPSVIFQQQVNSVSTRHIQPDGKGAFDFVWTHFGFED
DSEEMTQRRLRQANLFGPAGFVSADDGEVIEWSQEGFETKPAHRTLAELGGREVGDTDHM
VTETLIRGMYEYWRKVMEAEA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory