Comparing Ac3H11_2203 FitnessBrowser__acidovorax_3H11:Ac3H11_2203 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q58761 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
32% identity, 90% coverage: 19:290/303 of query aligns to 13:277/284 of Q58761
1u9zA Crystal structure of phosphoribosyl diphosphate synthase complexed with amp and ribose 5-phosphate (see paper)
31% identity, 90% coverage: 19:290/303 of query aligns to 13:267/274 of 1u9zA
Q97Z86 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
31% identity, 86% coverage: 20:280/303 of query aligns to 14:271/291 of Q97Z86
4twbA Sulfolobus solfataricus ribose-phosphate pyrophosphokinase (see paper)
30% identity, 86% coverage: 20:280/303 of query aligns to 14:258/278 of 4twbA
Q97CA5 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) (see paper)
25% identity, 84% coverage: 34:289/303 of query aligns to 28:273/286 of Q97CA5
3mbiA Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with adp-mg2+ and ribose 5- phosphate (see paper)
25% identity, 84% coverage: 34:289/303 of query aligns to 30:275/287 of 3mbiA
3lpnA Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with an atp analog (ampcpp). (see paper)
25% identity, 84% coverage: 34:289/303 of query aligns to 28:273/284 of 3lpnA
Sites not aligning to the query:
3mbiD Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with adp-mg2+ and ribose 5- phosphate (see paper)
25% identity, 84% coverage: 34:289/303 of query aligns to 28:273/285 of 3mbiD
P0A717 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Escherichia coli (strain K12) (see 4 papers)
29% identity, 98% coverage: 3:300/303 of query aligns to 1:303/315 of P0A717
6asvC E. Coli prpp synthetase (see paper)
29% identity, 95% coverage: 12:300/303 of query aligns to 5:301/311 of 6asvC
4s2uA Crystal structure of the phosphorybosylpyrophosphate synthetase from e. Coli
29% identity, 95% coverage: 12:300/303 of query aligns to 6:302/308 of 4s2uA
7xmvA E.Coli phosphoribosylpyrophosphate (prpp) synthetase type a(amp/adp) filament bound with adp, amp and r5p (see paper)
29% identity, 95% coverage: 12:300/303 of query aligns to 5:295/307 of 7xmvA
7xmuA E.Coli phosphoribosylpyrophosphate (prpp) synthetase type a filament bound with adp, pi and r5p (see paper)
29% identity, 95% coverage: 12:300/303 of query aligns to 5:295/307 of 7xmuA
Q63XL8 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Burkholderia pseudomallei (strain K96243) (see paper)
28% identity, 96% coverage: 9:300/303 of query aligns to 7:305/318 of Q63XL8
O94413 Ribose-phosphate pyrophosphokinase 2; Phosphoribosyl pyrophosphate synthase 2; EC 2.7.6.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 93% coverage: 19:300/303 of query aligns to 18:306/321 of O94413
3dahC 2.3 a crystal structure of ribose-phosphate pyrophosphokinase from burkholderia pseudomallei (see paper)
29% identity, 96% coverage: 9:300/303 of query aligns to 2:293/300 of 3dahC
6nfeB Crystal structure of ribose-phosphate pyrophosphokinase from legionella pneumophila with bound amp, adp, and ribose-5-phosphate
30% identity, 87% coverage: 38:300/303 of query aligns to 34:297/299 of 6nfeB
6nfeA Crystal structure of ribose-phosphate pyrophosphokinase from legionella pneumophila with bound amp, adp, and ribose-5-phosphate
30% identity, 87% coverage: 38:300/303 of query aligns to 34:296/298 of 6nfeA
8dbkB Human prps1 with phosphate, atp, and r5p; hexamer with resolved catalytic loops (see paper)
28% identity, 87% coverage: 19:282/303 of query aligns to 15:276/316 of 8dbkB
8dbeA Human prps1 with adp; hexamer (see paper)
28% identity, 87% coverage: 19:282/303 of query aligns to 15:276/316 of 8dbeA
Sites not aligning to the query:
>Ac3H11_2203 FitnessBrowser__acidovorax_3H11:Ac3H11_2203
MALPDASCVLYFDDEAAPAQRLAQAAGLTAQAIERHRFPDGELKLRLPVDASGRLPQRAV
LLRSLHQPNEKLVELLLAARTARQLGAQHLTLVAPYLAYMRQDIAFHPGEAVSQQVVGGF
LAGLFDAVITVDPHLHRIERLEQAMPVTQAVVLSGAEPLADLIAQRRPGALLVGPDGESA
QWIAQAAARHSFDHAVCTKVRHGDRNVAIELPALNAQGRAVVLLDDMASTGRTLALATRL
LLQAGAASVDVAVTHALFAGDALQVLTEAGVGEVWSTDCIPHPSNAVAMAGPLAAALHRV
LAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory