SitesBLAST
Comparing Ac3H11_2239 FitnessBrowser__acidovorax_3H11:Ac3H11_2239 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
29% identity, 91% coverage: 69:757/759 of query aligns to 1:719/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (≠ F104), G39 (= G105), Q40 (= Q106), H41 (≠ G107), V42 (= V108), A45 (≠ G111), G79 (= G149), G80 (= G150), S81 (= S151), S83 (= S153), V84 (≠ I154), G374 (= G432), F375 (= F433), L379 (≠ A437), L499 (≠ W555), R500 (= R556), V624 (= V661), D625 (≠ N662), Q632 (= Q669), T687 (= T725), G688 (= G726), L689 (≠ M727), G690 (= G728), E691 (= E729)
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
23% identity, 52% coverage: 231:624/759 of query aligns to 7:429/748 of 5y6qC
Sites not aligning to the query:
- active site: 715, 716
- binding pterin cytosine dinucleotide: 461, 462, 463, 464, 468, 500, 502, 503, 504, 505, 638, 640, 641, 648, 711, 713, 714, 715
1t3qB Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
23% identity, 47% coverage: 231:586/759 of query aligns to 14:401/786 of 1t3qB
Sites not aligning to the query:
- active site: 743, 744
- binding pterin cytosine dinucleotide: 506, 507, 508, 510, 513, 545, 547, 549, 550, 666, 670, 674, 675, 678, 739, 740, 741, 742
1ffvB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
23% identity, 45% coverage: 246:586/759 of query aligns to 27:409/797 of 1ffvB
- active site: Q231 (= Q402), V266 (≠ A437), P343 (≠ D524), I349 (≠ G530), R378 (≠ W555), C379 (≠ R556)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): G260 (= G431), G261 (= G432), F262 (= F433), G263 (= G434), A376 (≠ L553), R378 (≠ W555), C379 (≠ R556)
Sites not aligning to the query:
- active site: 751, 752
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 516, 517, 518, 520, 523, 556, 557, 558, 560, 561, 674, 678, 683, 686, 747, 748, 749, 750, 751
1ffuB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
23% identity, 45% coverage: 246:586/759 of query aligns to 27:409/797 of 1ffuB
Sites not aligning to the query:
- active site: 751, 752
- binding cytidine-5'-diphosphate: 518, 520, 523, 558, 560, 561, 674, 676, 678, 683, 747, 748, 749, 750
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
24% identity, 48% coverage: 227:587/759 of query aligns to 14:381/731 of 5g5gC
Sites not aligning to the query:
- active site: 692, 693
- binding pterin cytosine dinucleotide: 468, 469, 470, 507, 509, 511, 512, 617, 618, 621, 625, 688, 690, 691, 692
P19913 Carbon monoxide dehydrogenase large chain; CO dehydrogenase subunit L; CO-DH L; EC 1.2.5.3 from Hydrogenophaga pseudoflava (Pseudomonas carboxydoflava) (see paper)
23% identity, 45% coverage: 246:586/759 of query aligns to 33:415/803 of P19913
- R384 (≠ W555) modified: 4-hydroxyarginine
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
24% identity, 48% coverage: 227:587/759 of query aligns to 14:381/732 of P77489
Sites not aligning to the query:
- 440 mutation R->H,K: Decrease in catalytic efficiency.
- 468:470 binding
- 511:512 binding
- 615:621 binding
- 625 binding
- 688:691 binding
- 692 E→Q: Loss of activity.
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
34% identity, 16% coverage: 634:756/759 of query aligns to 617:745/761 of 1rm6A
- active site: E718 (vs. gap), G719 (vs. gap)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): L646 (≠ V661), N647 (= N662), V651 (= V666), Q654 (= Q669), K714 (≠ G728), E715 (= E729), A716 (≠ P730), S717 (≠ G731), E718 (vs. gap)
Sites not aligning to the query:
- active site: 206, 241, 318, 322, 350
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 235, 236, 237, 238, 350, 473, 474, 475, 476, 513, 514, 515, 517, 518
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
34% identity, 16% coverage: 634:756/759 of query aligns to 625:753/769 of O33819
Sites not aligning to the query:
- 214 binding
- 244:245 binding
- 522:526 binding
2ckjA Human milk xanthine oxidoreductase
27% identity, 41% coverage: 200:507/759 of query aligns to 492:814/1264 of 2ckjA
Sites not aligning to the query:
- active site: 824, 828, 856, 1204, 1205
- binding flavin-adenine dinucleotide: 228, 230, 231, 232, 233, 234, 308, 309, 317, 318, 321, 322, 324, 325, 331, 375
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 111, 112, 114, 146, 147, 148
3zyvB Crystal structure of the mouse liver aldehyde oxidase 3 (maox3) (see paper)
26% identity, 51% coverage: 203:586/759 of query aligns to 510:891/1262 of 3zyvB
Sites not aligning to the query:
- active site: 1207, 1208
- binding flavin-adenine dinucleotide: 227, 229, 230, 231, 232, 233, 234, 267, 303, 304, 312, 313, 316, 317, 319, 325, 326, 366, 392, 393
- binding fe2/s2 (inorganic) cluster: 39, 41, 42, 44, 46, 49, 69, 71, 111, 112, 114, 146, 148
2e1qA Crystal structure of human xanthine oxidoreductase mutant, glu803val (see paper)
26% identity, 48% coverage: 208:575/759 of query aligns to 530:906/1307 of 2e1qA
- active site: Q742 (= Q402), V777 (≠ A437), R855 (≠ T526), H859 (≠ G530), R887 (= R556)
- binding bicarbonate ion: R814 (= R479), H815 (≠ P480), I852 (= I523), F886 (≠ W555), F889 (≠ V558), G890 (= G559), Q893 (≠ H562)
- binding calcium ion: E715 (≠ A377), H716 (= H378), Y718 (≠ P380), T741 (= T401), T747 (≠ D407), S780 (≠ T440), T781 (≠ S441), S784 (≠ A447), T811 (≠ K474), G812 (= G475)
- binding fe2/s2 (inorganic) cluster: L719 (≠ M381)
- binding hydroxy(dioxo)molybdenum: F773 (= F433), G774 (= G434), R887 (= R556)
Sites not aligning to the query:
- active site: 1235, 1236
- binding flavin-adenine dinucleotide: 43, 44, 230, 231, 232, 233, 234, 235, 236, 237, 238, 311, 312, 316, 320, 321, 324, 325, 327, 328, 333, 334, 377, 378
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
- binding hydroxy(dioxo)molybdenum: 1053, 1054, 1236
P47989 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Homo sapiens (Human) (see 4 papers)
27% identity, 40% coverage: 208:507/759 of query aligns to 556:871/1333 of P47989
- D584 (≠ K241) to A: in dbSNP:rs45491693
- R607 (≠ V263) to Q: in dbSNP:rs45442092
- K617 (= K273) to N: in dbSNP:rs45442398
- T623 (≠ D279) to I: in dbSNP:rs45448694
- I646 (≠ G302) to V: in dbSNP:rs17323225
- I703 (vs. gap) to V: in dbSNP:rs17011368
- L763 (= L397) to F: in a breast cancer sample; somatic mutation
- R791 (≠ N425) to G: in a breast cancer sample; somatic mutation; dbSNP:rs775646772
Sites not aligning to the query:
- 133 E → K: in dbSNP:rs45447191
- 172 G → R: in dbSNP:rs45523133
- 235 T → M: in dbSNP:rs45469499
- 257:264 binding
- 337 binding
- 347:351 binding
- 360 binding
- 395 K → M: in dbSNP:rs34929837
- 422 binding
- 509 modified: Disulfide link with 1318, In oxidase form
- 536 modified: Disulfide link with 993, In oxidase form
- 555 P → S: in dbSNP:rs45577338
- 910 T → M: in dbSNP:rs669884
- 993 modified: Disulfide link with 536, In oxidase form
- 1091 V → L: in dbSNP:rs45619033
- 1109 N → T: in dbSNP:rs45547640
- 1150 P → R: in dbSNP:rs1042036
- 1176 R → C: in dbSNP:rs45624433
- 1296 R → W: in dbSNP:rs45564939
- 1318 modified: Disulfide link with 509, In oxidase form
7dqxD Crystal structure of xanthine dehydrogenase family protein
24% identity, 45% coverage: 231:572/759 of query aligns to 6:379/770 of 7dqxD
Sites not aligning to the query:
- binding pterin cytosine dinucleotide: 491, 492, 493, 494, 498, 530, 531, 532, 533, 534, 535, 536, 658, 659, 662, 725, 726, 727, 728
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
23% identity, 48% coverage: 226:587/759 of query aligns to 2:381/420 of 3hrdE
- active site: Q207 (= Q402), L242 (≠ A437), R318 (≠ K520), H322 (≠ D524), R350 (= R556)
- binding calcium ion: T206 (= T401), N208 (≠ M403), D212 (= D407), K241 (≠ R436), L242 (≠ A437), D243 (= D442)
- binding pterin cytosine dinucleotide: G237 (= G432), F238 (= F433), R350 (= R556)
- binding selenium atom: F238 (= F433), A348 (vs. gap), F349 (≠ W555), R350 (= R556)
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
23% identity, 48% coverage: 226:587/759 of query aligns to 2:381/420 of 3hrdA
- active site: Q207 (= Q402), L242 (≠ A437), R318 (≠ K520), H322 (≠ D524), R350 (= R556)
- binding pterin cytosine dinucleotide: G236 (= G431), G237 (= G432), F238 (= F433), R350 (= R556)
- binding magnesium ion: T206 (= T401), N208 (≠ M403), D212 (= D407), K241 (≠ R436), L242 (≠ A437), D243 (= D442), T305 (≠ S507), Y308 (≠ K510), A309 (≠ G511), S346 (≠ L553)
- binding nicotinic acid: A314 (= A516), R318 (≠ K520), F352 (≠ V558)
- binding selenium atom: F238 (= F433), G239 (= G434), A348 (vs. gap), F349 (≠ W555), R350 (= R556)
6a7xB Rat xanthine oxidoreductase, d428a variant, NAD bound form
25% identity, 39% coverage: 208:500/759 of query aligns to 526:831/1291 of 6a7xB
Sites not aligning to the query:
- active site: 851, 855, 883, 1231, 1232
- binding bicarbonate ion: 880, 881, 885, 886, 889
- binding flavin-adenine dinucleotide: 44, 227, 228, 229, 230, 231, 232, 233, 234, 307, 312, 317, 320, 321, 323, 324, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 327, 363, 364, 428, 430, 431, 471, 478
- binding uric acid: 851, 885, 980, 981, 1049, 1050, 1232
P22985 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Rattus norvegicus (Rat) (see 2 papers)
25% identity, 39% coverage: 208:500/759 of query aligns to 555:860/1331 of P22985
Sites not aligning to the query:
- 43 binding
- 48 binding
- 51 binding
- 73 binding
- 112 binding
- 115 binding
- 147 binding
- 149 binding
- 256:263 binding
- 335:336 WF→AL: Converts the enzyme to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
- 346:350 binding
- 359 binding
- 403 binding
- 535 C→A: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with R-992. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with R-992 and S-1316.
- 992 C→R: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with A-535. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and S-1316.
- 1316 C→S: Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and R-992.
Q0QLF2 Nicotinate dehydrogenase large molybdopterin subunit; NDH; Nicotinic acid hydroxylase large molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see 2 papers)
23% identity, 48% coverage: 226:587/759 of query aligns to 3:382/425 of Q0QLF2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:425 modified: mature protein, Nicotinate dehydrogenase large molybdopterin subunit
Query Sequence
>Ac3H11_2239 FitnessBrowser__acidovorax_3H11:Ac3H11_2239
MHFEPSAVAAARHHMPKNLLALMDKAQVATDSIANDAADGMARRTFLKVTAASGFALGAF
PLAATAQGAGAAAPAGLKPHEQPSAFVRIDADGTVTVTINRLDFGQGVQTGLPMILAEEL
DADWSKVRSVHGDANPAYADPAFGMHLTGGSNSIKNSYTQYRELGARTRAMLVGAAAAQW
GVDASALRTSNGFVVGPGGKKLGYGALAEAAMKQPVPEKVTLKDPKQFRIIGKPTGRLDA
KAKSSGQQDYGIDVRLPGMLTAVVARPPVFGAKPKSLDDSAAKAIKGVKAVLRVPTDRGG
EGVAIIADGYWPAKQGRDALKVEWDTSAVAKPDTTALLAQYRELAAKPGNVAMQADMAPL
AGAAHKISAEFVFPYLAHAPMEPLNCTVKLDADKAELWMGTQMPGLDAMAAAKTLGLQPQ
NVKVNTQMAGGGFGRRAIPTSDYVVEACGVAKAARTVGITAPVRTLWSREDDIKGGYYRP
MHVHRAEIGFDAQGKVLAWDHSIVGQSITKGSPFEAFMVKNGIDATAIEGMKEPYDLPMK
LTVHHPDVNVPVLWWRSVGSTHTAYVMETLIDEVARATKQDPVAYRMALMGDKHPRHKAA
LQLAVAQSGYGKKKLAAGRAWGVAVHESFQSVVAYVVEASVKDGTPKLHSITAGVHCNLV
VNPKSVEAQVQGGALMGLSMCLPGAAITLKDGVVEQSNFGDFAVPRITDMPQVAVHIVPS
AEPPTGMGEPGLPPLAPAFANAVARLTGKTPRELPFKLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory