SitesBLAST
Comparing Ac3H11_2257 FitnessBrowser__acidovorax_3H11:Ac3H11_2257 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
42% identity, 89% coverage: 19:256/267 of query aligns to 6:251/255 of 5itvA
- active site: G18 (= G31), S141 (= S151), Y154 (= Y164), K158 (= K168)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G27), S17 (≠ Q30), G18 (= G31), I19 (= I32), D38 (= D51), I39 (≠ V52), T61 (≠ C71), I63 (≠ V73), N89 (= N99), G91 (= G101), T139 (≠ M149), S141 (= S151), Y154 (= Y164), K158 (= K168), P184 (= P194), G185 (= G195), I186 (≠ T196), I187 (= I197)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
40% identity, 89% coverage: 19:256/267 of query aligns to 6:223/227 of 5itvD
- active site: G18 (= G31), S141 (= S151), Y154 (= Y164), K158 (= K168)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G27), S17 (≠ Q30), G18 (= G31), I19 (= I32), D38 (= D51), I39 (≠ V52), T61 (≠ C71), D62 (= D72), I63 (≠ V73), N89 (= N99), T139 (≠ M149), S141 (= S151), Y154 (= Y164), K158 (= K168), P184 (= P194), G185 (= G195), I187 (= I197)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
43% identity, 91% coverage: 20:262/267 of query aligns to 5:240/240 of 2d1yA
- active site: G16 (= G31), S135 (= S151), N145 (≠ I161), Y148 (= Y164), K152 (= K168)
- binding nicotinamide-adenine-dinucleotide: G12 (= G27), R15 (≠ Q30), I17 (= I32), D36 (= D51), L37 (≠ V52), R38 (≠ D53), V55 (≠ C71), D56 (= D72), L57 (≠ V73), N83 (= N99), A84 (= A100), A85 (≠ G101), I86 (= I102), V133 (≠ M149), S135 (= S151), Y148 (= Y164), K152 (= K168), P178 (= P194), G179 (= G195), I181 (= I197), T183 (= T199), A185 (≠ L201), V186 (≠ A202)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
41% identity, 89% coverage: 21:258/267 of query aligns to 8:243/244 of 4nbuB
- active site: G18 (= G31), N111 (= N123), S139 (= S151), Q149 (≠ I161), Y152 (= Y164), K156 (= K168)
- binding acetoacetyl-coenzyme a: D93 (≠ A105), K98 (≠ E110), S139 (= S151), N146 (≠ I158), V147 (≠ P159), Q149 (≠ I161), Y152 (= Y164), F184 (≠ T196), M189 (≠ L201), K200 (= K215)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G27), N17 (≠ Q30), G18 (= G31), I19 (= I32), D38 (= D51), F39 (≠ V52), V59 (≠ C71), D60 (= D72), V61 (= V73), N87 (= N99), A88 (= A100), G89 (= G101), I90 (= I102), T137 (≠ M149), S139 (= S151), Y152 (= Y164), K156 (= K168), P182 (= P194), F184 (≠ T196), T185 (≠ I197), T187 (= T199), M189 (≠ L201)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
40% identity, 91% coverage: 16:257/267 of query aligns to 1:243/248 of Q9KJF1
- M1 (≠ F16) modified: Initiator methionine, Removed
- S15 (≠ Q30) binding
- D36 (= D51) binding
- D62 (= D72) binding
- I63 (≠ V73) binding
- N89 (= N99) binding
- Y153 (= Y164) binding
- K157 (= K168) binding
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
40% identity, 89% coverage: 21:257/267 of query aligns to 5:242/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G27), M16 (≠ I32), D35 (= D51), I36 (≠ V52), I62 (≠ V73), N88 (= N99), G90 (= G101), I138 (≠ M149), S140 (= S151), Y152 (= Y164), K156 (= K168), I185 (= I197)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
38% identity, 90% coverage: 20:258/267 of query aligns to 5:246/248 of 4urfB
- active site: G16 (= G31), S142 (= S151), I152 (= I161), Y155 (= Y164), K159 (= K168)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ M222), R211 (≠ K223), R212 (= R224)
- binding bicarbonate ion: I92 (= I102), G94 (≠ A106), R109 (≠ A118), R179 (= R188), S228 (= S240)
- binding nicotinamide-adenine-dinucleotide: G12 (= G27), G14 (≠ A29), N15 (≠ Q30), G16 (= G31), I17 (= I32), D36 (= D51), I37 (≠ V52), D62 (= D72), T63 (≠ V73), N89 (= N99), A90 (= A100), G91 (= G101), I140 (≠ M149), Y155 (= Y164), K159 (= K168), P185 (= P194), A186 (≠ G195), I188 (= I197), T190 (= T199)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
38% identity, 90% coverage: 20:258/267 of query aligns to 5:246/248 of 4urfA
- active site: G16 (= G31), S142 (= S151), I152 (= I161), Y155 (= Y164), K159 (= K168)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (= I102), S93 (≠ A105), G94 (≠ A106), E95 (≠ D107), T97 (≠ L109), E101 (= E110), T103 (= T112), Q106 (≠ D115), R109 (≠ A118), S175 (≠ D184), G177 (≠ N186)
- binding magnesium ion: S237 (≠ E249), Y238 (≠ I250)
- binding nicotinamide-adenine-dinucleotide: G12 (= G27), G14 (≠ A29), N15 (≠ Q30), G16 (= G31), I17 (= I32), D36 (= D51), I37 (≠ V52), W41 (≠ R56), D62 (= D72), T63 (≠ V73), N89 (= N99), A90 (= A100), G91 (= G101), I140 (≠ M149), Y155 (= Y164), K159 (= K168), P185 (= P194), I188 (= I197), T190 (= T199)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
38% identity, 90% coverage: 20:258/267 of query aligns to 5:246/248 of 4ureB
- active site: G16 (= G31), S142 (= S151), I152 (= I161), Y155 (= Y164), K159 (= K168)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ Q30), G16 (= G31), I17 (= I32), N89 (= N99), G91 (= G101), Y155 (= Y164), P185 (= P194), A186 (≠ G195)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
42% identity, 89% coverage: 20:256/267 of query aligns to 5:236/239 of 4nbtA
- active site: G16 (= G31), S132 (= S151), Y145 (= Y164), K149 (= K168)
- binding nicotinamide-adenine-dinucleotide: G12 (= G27), K15 (≠ Q30), G16 (= G31), L17 (≠ I32), D36 (= D51), L37 (≠ V52), L52 (≠ V69), N53 (≠ D72), V54 (= V73), N80 (= N99), A81 (= A100), G82 (= G101), I130 (≠ M149), S132 (= S151), Y145 (= Y164), K149 (= K168), P177 (= P194), G178 (= G195), I180 (= I197), T182 (= T199)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
39% identity, 93% coverage: 20:266/267 of query aligns to 10:258/258 of 4wecA
- active site: G21 (= G31), S143 (= S151), Q154 (≠ I161), Y157 (= Y164), K161 (= K168)
- binding nicotinamide-adenine-dinucleotide: G17 (= G27), A19 (= A29), S20 (≠ Q30), G21 (= G31), I22 (= I32), D41 (= D51), I42 (≠ V52), V61 (≠ C71), D62 (= D72), V63 (= V73), N89 (= N99), T141 (≠ M149), Y157 (= Y164), K161 (= K168), P187 (= P194), P189 (≠ T196), V190 (≠ I197)
7xqmB Indel-mutant short chain dehydrogenase bound to sah (see paper)
42% identity, 92% coverage: 20:264/267 of query aligns to 6:248/253 of 7xqmB
- binding s-adenosyl-l-homocysteine: G13 (= G27), I16 (= I32), D34 (= D51), L35 (≠ V52), R36 (≠ D53), V53 (≠ C71), L55 (≠ V73), N81 (= N99), A82 (= A100), A83 (≠ G101), Y146 (= Y164)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
39% identity, 88% coverage: 21:256/267 of query aligns to 9:244/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G27), R18 (≠ Q30), G19 (= G31), I20 (= I32), D39 (= D51), R40 (≠ D53), C63 (= C71), I65 (≠ V73), N91 (= N99), G93 (= G101), I94 (= I102), V114 (= V122), Y155 (= Y164), K159 (= K168), I188 (= I197), T190 (= T199), T193 (≠ A202)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
38% identity, 90% coverage: 20:258/267 of query aligns to 5:242/244 of 7krmC
- active site: G18 (= G31), S140 (= S151), Y155 (= Y164)
- binding nicotinamide-adenine-dinucleotide: G12 (= G27), S15 (vs. gap), G18 (= G31), I19 (= I32), D38 (= D51), L39 (≠ V52), A60 (≠ C71), N61 (≠ D72), V62 (= V73), N88 (= N99), V111 (= V122), S140 (= S151), Y155 (= Y164), K159 (= K168), I188 (= I197), T190 (= T199)
3lqfA Crystal structure of the short-chain dehydrogenase galactitol- dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD and erythritol (see paper)
43% identity, 93% coverage: 16:264/267 of query aligns to 7:253/254 of 3lqfA
- active site: G22 (= G31), S144 (= S151), Y159 (= Y164), K163 (= K168)
- binding meso-erythritol: N151 (≠ A157), Y159 (= Y164), Y191 (≠ T196), T197 (≠ A202), M200 (≠ V206)
- binding nicotinamide-adenine-dinucleotide: G18 (= G27), S21 (≠ Q30), G22 (= G31), I23 (= I32), D42 (= D51), R43 (≠ V52), D66 (= D72), V67 (= V73), S92 (≠ N99), L142 (≠ M149), S144 (= S151), K163 (= K168), P189 (= P194), V192 (≠ I197), T194 (= T199), M196 (≠ L201), T197 (≠ A202)
2wsbA Crystal structure of the short-chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD (see paper)
43% identity, 93% coverage: 16:264/267 of query aligns to 7:253/254 of 2wsbA
- active site: G22 (= G31), S144 (= S151), Y159 (= Y164), K163 (= K168)
- binding nicotinamide-adenine-dinucleotide: G18 (= G27), S21 (≠ Q30), G22 (= G31), I23 (= I32), D42 (= D51), R43 (≠ V52), D66 (= D72), V67 (= V73), S92 (≠ N99), A93 (= A100), L142 (≠ M149), S144 (= S151), Y159 (= Y164), K163 (= K168), P189 (= P194), V192 (≠ I197), T194 (= T199), M196 (≠ L201), T197 (≠ A202)
- binding n-propanol: S144 (= S151), M145 (≠ V152), N151 (≠ A157), N151 (≠ A157), Y159 (= Y164), Y159 (= Y164), Y191 (≠ T196)
2wdzA Crystal structure of the short chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD+ and 1,2-pentandiol (see paper)
43% identity, 93% coverage: 16:264/267 of query aligns to 7:253/254 of 2wdzA
- active site: G22 (= G31), S144 (= S151), Y159 (= Y164), K163 (= K168)
- binding (2S)-pentane-1,2-diol: A45 (≠ D54), D49 (≠ Q58), R62 (vs. gap), S146 (≠ N153), Y159 (= Y164)
- binding nicotinamide-adenine-dinucleotide: G18 (= G27), S21 (≠ Q30), G22 (= G31), I23 (= I32), D42 (= D51), R43 (≠ V52), A65 (≠ C71), D66 (= D72), V67 (= V73), S92 (≠ N99), A93 (= A100), L142 (≠ M149), S144 (= S151), Y159 (= Y164), K163 (= K168), P189 (= P194), V192 (≠ I197), T194 (= T199), M196 (≠ L201), T197 (≠ A202)
C0KTJ6 Galactitol 2-dehydrogenase (L-tagatose-forming); Galactitol dehydrogenase; GDH; GatDH; Galactitol:NAD(+) 5-oxidoreductase; EC 1.1.1.406 from Cereibacter sphaeroides (Rhodobacter sphaeroides) (see paper)
43% identity, 93% coverage: 16:264/267 of query aligns to 7:253/254 of C0KTJ6
Sites not aligning to the query:
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
38% identity, 89% coverage: 20:256/267 of query aligns to 5:244/247 of 4jroC
- active site: G16 (= G31), S142 (= S151), Q152 (≠ I161), Y155 (= Y164), K159 (= K168)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G27), S14 (≠ A29), R15 (≠ Q30), G16 (= G31), I17 (= I32), N35 (≠ D54), Y36 (≠ A55), N37 (≠ R56), G38 (= G57), S39 (≠ Q58), N63 (≠ D72), V64 (= V73), N90 (= N99), A91 (= A100), I93 (= I102), I113 (≠ V122), S142 (= S151), Y155 (= Y164), K159 (= K168), P185 (= P194), I188 (= I197), T190 (= T199)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
39% identity, 94% coverage: 7:257/267 of query aligns to 3:263/267 of Q9LBG2
- 17:42 (vs. 24:49, 50% identical) binding
- E103 (≠ F103) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
Query Sequence
>Ac3H11_2257 FitnessBrowser__acidovorax_3H11:Ac3H11_2257
MNPSSPAPSLPSSIYFGHTGRVCIVTGGAQGIGEACVRRFAAEGAKPVIVDVDDARGQAL
AAELGALYVRCDVGDKAQVDALVAQVLAAHGRIDVLVNNAGIFRAADFLEVTEADFDAVL
RVNLKGSFLVGQAVARAMVTSGGGAIVNMSSVNGVLAIPNIASYNVSKGGVNQLTRVMAL
ALADKNIRVNAVAPGTIATELAAKAVLTSDEAKRKIMSRTPMKRLGQPSEIADVVAWLAS
DAASYVTGEIVTVDGGRMTLNYTVPVQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory