Comparing Ac3H11_2296 FitnessBrowser__acidovorax_3H11:Ac3H11_2296 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
3tdtA Complex of tetrahydrodipicolinate n-succinyltransferase with 2-amino- 6-oxopimelate and coenzyme a (see paper)
66% identity, 99% coverage: 3:276/277 of query aligns to 2:271/274 of 3tdtA
2tdtA Complex of tetrahydrodipicolinate n-succinyltransferase with 2- aminopimelate and coenzyme a (see paper)
66% identity, 99% coverage: 3:276/277 of query aligns to 2:271/274 of 2tdtA
1kgtA Crystal structure of tetrahydrodipicolinate n-succinyltransferase in complex with pimelate and succinyl-coa (see paper)
66% identity, 99% coverage: 3:276/277 of query aligns to 2:271/274 of 1kgtA
1kgqA Crystal structure of tetrahydrodipicolinate n-succinyltransferase in complex with l-2-aminopimelate and succinamide-coa (see paper)
66% identity, 99% coverage: 3:276/277 of query aligns to 2:271/274 of 1kgqA
3r8yA Structure of the bacillus anthracis tetrahydropicolinate succinyltransferase
41% identity, 35% coverage: 99:196/277 of query aligns to 70:168/203 of 3r8yA
7kr9A Bifunctional enzyme glmu bound to zn(ii) (see paper)
30% identity, 43% coverage: 97:215/277 of query aligns to 309:425/453 of 7kr9A
1hm9A Crystal structure of s.Pneumoniae n-acetylglucosamine-1-phosphate uridyltransferase, glmu, bound to acetyl coenzyme a and udp-n- acetylglucosamine (see paper)
30% identity, 43% coverage: 97:215/277 of query aligns to 314:430/458 of 1hm9A
Sites not aligning to the query:
1hm8A Crystal structure of s.Pneumoniae n-acetylglucosamine-1-phosphate uridyltransferase, glmu, bound to acetyl coenzyme a (see paper)
30% identity, 43% coverage: 97:215/277 of query aligns to 314:430/458 of 1hm8A
Sites not aligning to the query:
4ac3A S.Pneumoniae glmu in complex with an antibacterial inhibitor (see paper)
30% identity, 43% coverage: 97:215/277 of query aligns to 312:428/456 of 4ac3A
Sites not aligning to the query:
4aawA S.Pneumoniae glmu in complex with an antibacterial inhibitor (see paper)
30% identity, 43% coverage: 97:215/277 of query aligns to 311:427/455 of 4aawA
Sites not aligning to the query:
Q97R46 Bifunctional protein GlmU; EC 2.7.7.23; EC 2.3.1.157 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see 2 papers)
29% identity, 43% coverage: 97:215/277 of query aligns to 315:431/459 of Q97R46
Sites not aligning to the query:
1g97A S.Pneumoniae glmu complexed with udp-n-acetylglucosamine and mg2+ (see paper)
29% identity, 43% coverage: 97:215/277 of query aligns to 314:430/446 of 1g97A
Sites not aligning to the query:
>Ac3H11_2296 FitnessBrowser__acidovorax_3H11:Ac3H11_2296
MTQQLQTIIDNAWDNRASLSPAAAPKEIQDAVEHVIAELNNGTLRVATREGVGQWTVHQW
IKKAVLLSFRLKDNEVVKAGDLGFYDKVQTKFAHLSEEEMKATGVRVVPPAVARRGSFIA
KGAILMPSYVNIGAYVGEGTMVDTWATVGSCAQIGSNVHLSGGVGIGGVLEPLQAGPTII
EDNCFIGARSEVVEGVVVEENSVLGMGVYLGQSTPIFNRATGEISYGRVPSGSVVVSGNL
PKTAANGAPYSMYAAIIVKQVDAQTRSKTSINDLLRD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory