Comparing Ac3H11_2298 FitnessBrowser__acidovorax_3H11:Ac3H11_2298 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
58% identity, 97% coverage: 2:387/397 of query aligns to 3:376/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
58% identity, 97% coverage: 2:385/397 of query aligns to 3:374/375 of 4pqaA
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
58% identity, 94% coverage: 15:388/397 of query aligns to 16:377/377 of 7t1qA
7lgpB Dape enzyme from shigella flexneri
54% identity, 97% coverage: 4:387/397 of query aligns to 7:377/377 of 7lgpB
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
50% identity, 96% coverage: 3:385/397 of query aligns to 4:374/377 of P44514
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
50% identity, 96% coverage: 3:385/397 of query aligns to 8:378/380 of 5vo3A
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
52% identity, 48% coverage: 2:191/397 of query aligns to 3:180/265 of 4op4B
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
50% identity, 49% coverage: 3:197/397 of query aligns to 6:186/258 of 4h2kA
Sites not aligning to the query:
7rsfA Acetylornithine deacetylase from escherichia coli
27% identity, 96% coverage: 5:385/397 of query aligns to 6:377/380 of 7rsfA
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
29% identity, 38% coverage: 71:220/397 of query aligns to 97:236/426 of 3pfoA
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
31% identity, 43% coverage: 22:192/397 of query aligns to 82:246/507 of Q96KN2
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
32% identity, 43% coverage: 29:200/397 of query aligns to 53:221/471 of 3dljA
Sites not aligning to the query:
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
24% identity, 91% coverage: 11:370/397 of query aligns to 30:442/458 of 2pokA
Sites not aligning to the query:
2zogA Crystal structure of mouse carnosinase cn2 complexed with zn and bestatin (see paper)
22% identity, 67% coverage: 71:336/397 of query aligns to 96:421/478 of 2zogA
Sites not aligning to the query:
2zofA Crystal structure of mouse carnosinase cn2 complexed with mn and bestatin (see paper)
22% identity, 67% coverage: 71:336/397 of query aligns to 96:421/478 of 2zofA
Sites not aligning to the query:
Q9D1A2 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Threonyl dipeptidase; EC 3.4.13.18 from Mus musculus (Mouse) (see 2 papers)
22% identity, 67% coverage: 71:336/397 of query aligns to 92:417/475 of Q9D1A2
Sites not aligning to the query:
Q96KP4 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Peptidase A; Threonyl dipeptidase; EC 3.4.13.18 from Homo sapiens (Human)
28% identity, 43% coverage: 71:239/397 of query aligns to 92:260/475 of Q96KP4
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
24% identity, 78% coverage: 60:368/397 of query aligns to 58:364/383 of 7uoiA
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
30% identity, 37% coverage: 64:209/397 of query aligns to 111:262/503 of Q8C165
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
22% identity, 92% coverage: 19:385/397 of query aligns to 29:398/408 of Q03154
>Ac3H11_2298 FitnessBrowser__acidovorax_3H11:Ac3H11_2298
MSRTLHLAEQLIALPSITPDDAGCLNLLAARLAPLGFECERLDSGPADFRVSNLWAKRPL
PRDQLAQAAIKTVVFAGHTDVVPTGPLAQWSSDPFVPTHKDGKLYGRGASDMKTSIAAFV
VAVEEFLAATPEPLVQLAFLLTSDEEGPSVDGTKVVVEQLKARGEPLDYCIVGEPTSVEK
TGDMIKNGRRGTLSGKLSVRGIQGHIAYPQLARNPIHQALPALAELAATVWDHGNAFFPP
TSWQISNMHGGTGATNVIPGEVVIDFNFRFSTESTAEGLQQRVHAMLDRHGLEYDLRWTL
GGQPFLTTPGELVTAVQQAITAETSITTELSTTGGTSDGRFIAQICPQVIELGPPNASIH
KIDEHVVVADIEPLKNIYRRTLENLHAQALAATAVPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory