Comparing Ac3H11_2339 FitnessBrowser__acidovorax_3H11:Ac3H11_2339 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5hwnB Crystal structure of keto-deoxy-d-galactarate dehydratase complexed with pyruvate (see paper)
53% identity, 98% coverage: 1:297/303 of query aligns to 1:296/310 of 5hwnB
4ur8A Crystal structure of keto-deoxy-d-galactarate dehydratase complexed with 2-oxoadipic acid (see paper)
53% identity, 98% coverage: 1:297/303 of query aligns to 1:296/304 of 4ur8A
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
31% identity, 87% coverage: 37:301/303 of query aligns to 27:289/292 of Q07607
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
30% identity, 71% coverage: 19:234/303 of query aligns to 10:226/296 of 7mjfA
Sites not aligning to the query:
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
30% identity, 71% coverage: 19:234/303 of query aligns to 10:226/296 of 7lvlA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
30% identity, 75% coverage: 10:236/303 of query aligns to 1:228/294 of Q8UGL3
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
29% identity, 75% coverage: 10:236/303 of query aligns to 1:228/294 of 4i7wA
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
31% identity, 78% coverage: 8:243/303 of query aligns to 1:233/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
31% identity, 78% coverage: 8:243/303 of query aligns to 1:233/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
31% identity, 78% coverage: 8:243/303 of query aligns to 1:233/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
31% identity, 78% coverage: 8:243/303 of query aligns to 1:233/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
31% identity, 78% coverage: 8:243/303 of query aligns to 1:233/291 of 3rk8A
Sites not aligning to the query:
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
31% identity, 78% coverage: 8:243/303 of query aligns to 1:233/291 of 3pueB
Sites not aligning to the query:
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
27% identity, 79% coverage: 10:248/303 of query aligns to 2:239/293 of 5t25A
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
27% identity, 79% coverage: 10:248/303 of query aligns to 1:238/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
27% identity, 79% coverage: 10:248/303 of query aligns to 1:238/292 of P0A6L2
3i7sA Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site. (see paper)
27% identity, 79% coverage: 10:248/303 of query aligns to 1:238/292 of 3i7sA
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
29% identity, 95% coverage: 14:301/303 of query aligns to 8:293/295 of 5ktlA
3di1B Crystal structure of the staphylococcus aureus dihydrodipicolinate synthase-pyruvate complex (see paper)
29% identity, 67% coverage: 37:240/303 of query aligns to 30:235/291 of 3di1B
Sites not aligning to the query:
Q5HG25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Staphylococcus aureus (strain COL) (see paper)
29% identity, 67% coverage: 37:240/303 of query aligns to 30:235/295 of Q5HG25
>Ac3H11_2339 FitnessBrowser__acidovorax_3H11:Ac3H11_2339
MTPQDLKTIMGSGLLSFPITDFDEQGNFRPKTYIERLEWLAPYGASALFAAGGTGEYFSL
SGPEYSEVIKTAVDTCRGKVPIIAGAGGPTRTAIAHAQEAERLGAHGILLLPHYLTEAGQ
EGLIEHVAQVCNSVKFGVIVYNRDRTKLTAESLAILAERCPNLIGFKDGVGNIETMSSIY
MKMGDRFSYLGGLPTAEVYAAAYKALGTPVYSSAVFNFIPKTAMDFYKAVAADDIATQHK
LLKEFFMPYLAIRNRVEGYGVSIIKAGAKIVGHDGGPVRAPLTDLKPHEVEELAALIKKL
GPQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory