Comparing Ac3H11_2374 FitnessBrowser__acidovorax_3H11:Ac3H11_2374 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
P70994 2-hydroxymuconate tautomerase; (2Z,4E)-2-hydroxyhexa-2,4-dienedioate keto-enol isomerase; 4-oxalocrotonate tautomerase; 4-OT; EC 5.3.2.6 from Bacillus subtilis (strain 168) (see paper)
33% identity, 83% coverage: 1:60/72 of query aligns to 1:59/62 of P70994
2opaA Ywhb binary complex with 2-fluoro-p-hydroxycinnamate
32% identity, 82% coverage: 2:60/72 of query aligns to 1:58/61 of 2opaA
Sites not aligning to the query:
>Ac3H11_2374 FitnessBrowser__acidovorax_3H11:Ac3H11_2374
MPYINIQITREGASREQKAQLIRGATDLVVQVLGKNPATTFVVIEEVDTDHWGIAGETVT
VLRERARQGGAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory