SitesBLAST
Comparing Ac3H11_2431 ABC transporter ATP-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
34% identity, 99% coverage: 1:511/514 of query aligns to 1:493/501 of P04983
- K43 (= K43) mutation to R: Loss of transport.
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 45% coverage: 4:234/514 of query aligns to 4:244/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 45% coverage: 4:234/514 of query aligns to 4:244/254 of 1g6hA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 42% coverage: 4:221/514 of query aligns to 2:217/241 of 4u00A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 42% coverage: 4:221/514 of query aligns to 1:222/343 of P30750
- 40:46 (vs. 39:45, 86% identical) binding
- E166 (= E166) mutation to Q: Exhibits little ATPase activity.
Sites not aligning to the query:
- 278:283 binding
- 295 N→A: Reduces the binding of L-methionine to undetectable levels.
- 295:296 binding
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
31% identity, 43% coverage: 3:221/514 of query aligns to 1:223/344 of 6cvlD
- binding phosphothiophosphoric acid-adenylate ester: F12 (= F14), Q14 (≠ K16), I19 (≠ L17), S41 (≠ N39), G42 (= G40), A43 (= A41), G44 (= G42), K45 (= K43), S46 (= S44), T47 (= T45), N141 (≠ S140), S143 (= S142), Q146 (≠ E145), H200 (= H198)
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
31% identity, 43% coverage: 3:221/514 of query aligns to 1:223/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
31% identity, 43% coverage: 3:221/514 of query aligns to 1:223/344 of 3tuiC
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 42% coverage: 4:221/514 of query aligns to 3:219/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 42% coverage: 4:221/514 of query aligns to 3:219/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 42% coverage: 4:221/514 of query aligns to 3:219/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 42% coverage: 4:221/514 of query aligns to 3:219/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
27% identity, 42% coverage: 7:221/514 of query aligns to 4:217/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (= F14), V16 (≠ A19), S36 (≠ N39), G37 (= G40), S38 (≠ A41), G39 (= G42), K40 (= K43), S41 (= S44), T42 (= T45), E162 (= E166), H194 (= H198)
- binding magnesium ion: S41 (= S44), E162 (= E166)
Q5SSE9 ATP-binding cassette sub-family A member 13; EC 7.6.2.- from Mus musculus (Mouse) (see paper)
32% identity, 40% coverage: 18:223/514 of query aligns to 3824:4025/5034 of Q5SSE9
- K3849 (= K43) mutation to M: Does not affect intracellular vesicle localization. Affects cholesterol internalization.
- T3999 (≠ S197) mutation to A: Does not affect protein expression. Affects intracellular vesicles localization. Impairs intracellular cholesterol accumulation in the vesicle.
Sites not aligning to the query:
- 3577 H→P: Does not affect protein expression. Decreases intracellular cholesterol accumulation in the vesicle.
- 4735 K→M: Does not affect intracellular vesicle localization.Affects cholesterol internalization.
- 4818 R→C: Does not affect protein expression. Decreases intracellular cholesterol accumulation in the vesicle.
E9Q876 Glucosylceramide transporter ABCA12; ATP-binding cassette sub-family A member 12; EC 7.6.2.1 from Mus musculus (Mouse) (see 2 papers)
32% identity, 41% coverage: 7:218/514 of query aligns to 1348:1555/2595 of E9Q876
- 1388:1461 (vs. 47:119, 28% identical) mutation to M: In a mouse model for harlequin ichthyosis (HI), smooth skin (smsk) mutant mice show a pronounced perinatal lethal skin phenotype in 25% of the offspring and newborn mutant pups die within a few hours after birth, and appear severely dehydrated with dry cracking skin. Smsk homozygous mutants embryos show a normal appearance at 14.5 dpc, but at 16.5 dpc develop a partial absence of normal skin folds around the trunk and limbs, and by 18.5 dpc develop a taut, thick skin and limb contractures.
Sites not aligning to the query:
- 1996 G→D: In a mouse model for harlequin ichthyosis (HI), homozygous mice are embryonic lethal but occasionally pups are found in the first few hours after birth but die and are severely dehydrated and fail to suckle normally. Homozygous pups show hallmarks of HI desease including hyperkeratosis, abnormal extracellular lipid lamellae and defects in cornified envelope processing. At 14.5 dpc and 15.5 dpc homozygous embryos appear normal; however from 16.5 dpc onwards they are characterized by an absence of normal skin folds around the trunk and limbs. As development progressed, embryos develop a taut, thick epidermis and multiple contractures affecting the limbs. Late stage embryos are smaller.
O95477 Phospholipid-transporting ATPase ABCA1; ATP-binding cassette sub-family A member 1; ATP-binding cassette transporter 1; ABC-1; ATP-binding cassette 1; Cholesterol efflux regulatory protein; EC 7.6.2.1 from Homo sapiens (Human) (see 35 papers)
30% identity, 40% coverage: 13:218/514 of query aligns to 909:1109/2261 of O95477
- D917 (= D21) to Y: in a colorectal cancer sample; somatic mutation
- T929 (≠ L33) to I: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; loss protein subcellular localization to the plasma membrane
- N935 (= N39) to S: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; dbSNP:rs28937313
- K939 (= K43) mutation to M: Inhibits ATPase activity; when associated with M-1952. Decreases translocase activity; when associated with M-1952. Does not affect protein subcellular localization in plasma membrane and endosome; when associated with M-1952.
- S1042 (≠ E150) modified: Phosphoserine; by PKA
- P1065 (= P173) natural variant: P -> S
- M1091 (≠ L200) to T: in FHA1; loss of localization to plasma membrane; decreased cholesterol efflux; decreased phospholipid efflux
Sites not aligning to the query:
- 3 modified: S-palmitoyl cysteine; C→S: Mild decrease of palmitoylation. Loss of localization to plasma membrane. Decreased cholesterol efflux. Decreased phospholipid efflux. Decreased palmitoylation; when associated with S-23, S-1110 and S-1111.
- 23 modified: S-palmitoyl cysteine; C→S: Mild decrease of palmitoylation. Loss of localization to plasma membrane. Decreased palmitoylation; when associated with S-3, S-1110 and S-1111.
- 74 I→C: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-371.; I→K: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with E-371.
- 75 modified: Disulfide link with 309
- 85 P → L: in FHA1; Alabama; dbSNP:rs145183203
- 98 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 100 S→C: Highly decreased protein abundance. Highly decreased ATPase activity. Highly decreased phospholipid translocase activity.
- 210 E → D: in a colorectal cancer sample; somatic mutation
- 219 R → K: in dbSNP:rs2230806
- 230 R → C: in dbSNP:rs9282541
- 244 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 248 P → A: in dbSNP:rs142625938
- 255 A → T: in TGD; deficient cellular cholesterol efflux; dbSNP:rs758100110
- 304 V→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane; when associated with C-308.
- 308 V→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane; when associated with C-304.
- 309 modified: Disulfide link with 75
- 364 S → C: in dbSNP:rs775035559
- 371 I→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane. 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-74 or C-375.; I→E: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-74.
- 375 L→C: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-371.
- 399 V → A: in dbSNP:rs9282543
- 401 K → Q: in dbSNP:rs138487227
- 496 R → W: in dbSNP:rs147675550
- 568 K→A: 60-65% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane.
- 573 Y→F: No effect on phospholipid and cholesterol efflux and on localization to cell membrane.
- 581 D→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-584 and K-585.
- 583 F→K: 90-95% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with E-590.
- 584 E→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-581 and K-585.
- 585 D→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-581 and K-584.
- 590 W → S: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; dbSNP:rs137854496; W→E: 90-95% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-583.
- 593 F→L: Moderately decreased protein abundance. Highly decreased ATPase activity. Highly decreased phospholipid translocase activity.
- 638 R → Q: in dbSNP:rs374190304
- 771 V → M: in dbSNP:rs2066718
- 774 T → P: in dbSNP:rs35819696; natural variant: T -> S
- 776 K → N: in dbSNP:rs138880920
- 815 E → G: in dbSNP:rs145582736
- 825 V → I: in dbSNP:rs2066715
- 883 I → M: in dbSNP:rs2066714
- 1110 modified: S-palmitoyl cysteine; C→S: Decreased palmitoylation; when associated with S-3, S-23 and S-1111.
- 1111 modified: S-palmitoyl cysteine; C→S: Decreased palmitoylation; when associated with S-3, S-23 and S-1110.
- 1172 E → D: in dbSNP:rs33918808
- 1181 S → F: in dbSNP:rs76881554
- 1216 G → V: in dbSNP:rs562403512
- 1341 R → T: in dbSNP:rs147743782
- 1376 S → G: in dbSNP:rs145689805
- 1379 L → F: in TGD; the mutant protein is retained in the endoplasmic reticulum while the wild-type protein is located at the plasma membrane
- 1407 A → T: in a colorectal cancer sample; somatic mutation; dbSNP:rs189206655
- 1463 modified: Disulfide link with 1477
- 1477 modified: Disulfide link with 1463; C → R: in TGD; loss of interaction with APOE; unable to generate APOE-containing high density lipoproteins; moderately decreased protein abundance; moderately decreased ATPase activity; moderately decreased phospholipid translocase activity; dbSNP:rs137854494
- 1512 T→M: Moderately decreased protein abundance. Does not affect ATPase activity. Moderately decreased phospholipid translocase activity.
- 1555 I → T: in dbSNP:rs1997618
- 1587 K → R: in dbSNP:rs2230808
- 1611 N → D: in FHA1; deficient cellular cholesterol efflux
- 1615 R → Q: in dbSNP:rs1251839800
- 1648 L → P: in dbSNP:rs1883024
- 1670 A → T: in dbSNP:rs1203589782
- 1680 R → Q: in dbSNP:rs150125857
- 1704 V → D: in TGD; the mutant protein is retained in the endoplasmic reticulum while the wild-type protein is located at the plasma membrane
- 1731 S → C: in dbSNP:rs760507032
- 1897 R → W: in FHA1; uncertain significance; dbSNP:rs760768125
- 1925 R → Q: in Scott syndrome; shows impaired trafficking of the mutant protein to the plasma membrane; dbSNP:rs142688906
- 1952 K→M: Inhibits ATPase activity; when associated with M-939. Decreases translocase activity; when associated with M-939. Does not affect protein subcellular localization in plasma membrane and endosome; when associated with M-939.
- 2054 modified: Phosphoserine; by PKA
- 2081 R → W: in TGD; highly decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; loss protein subcellular localization to the plasma membrane; dbSNP:rs137854501
- 2109 A → T: in a colorectal cancer sample; somatic mutation
- 2150 P → L: in FHA1; moderately decreased protein abundance; does not affect ATPase activity; moderately decreased phospholipid translocase activity; dbSNP:rs369098049
- 2163 natural variant: F -> S
- 2168 L → P: in dbSNP:rs2853577
- 2243 D → E: in dbSNP:rs34879708
- 2244 V → I: in dbSNP:rs144588452
P41233 Phospholipid-transporting ATPase ABCA1; ATP-binding cassette sub-family A member 1; ATP-binding cassette transporter 1; ABC-1; ATP-binding cassette 1; EC 7.6.2.1 from Mus musculus (Mouse) (see paper)
30% identity, 40% coverage: 13:218/514 of query aligns to 909:1109/2261 of P41233
Sites not aligning to the query:
- 489 modified: carbohydrate, N-linked (GlcNAc...) asparagine
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
29% identity, 46% coverage: 4:238/514 of query aligns to 2:235/240 of 6mjpA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
29% identity, 43% coverage: 3:222/514 of query aligns to 2:224/592 of 5lj7A
- binding adenosine-5'-triphosphate: V22 (≠ A19), S42 (≠ N39), G43 (= G40), G45 (= G42), K46 (= K43), S47 (= S44), T48 (= T45), Q92 (= Q86), K136 (≠ S133), Q143 (≠ S140), S145 (= S142), G147 (= G144), Q148 (≠ E145)
- binding magnesium ion: S47 (= S44), Q92 (= Q86)
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
29% identity, 43% coverage: 3:222/514 of query aligns to 2:224/615 of 5lilA
- binding adenosine-5'-triphosphate: F13 (= F14), V22 (= V18), S42 (≠ N39), G43 (= G40), G45 (= G42), K46 (= K43), S47 (= S44), T48 (= T45), Q92 (= Q86), K136 (≠ S133), Q143 (≠ S140), S145 (= S142), G147 (= G144), Q148 (≠ E145)
- binding magnesium ion: S47 (= S44), Q92 (= Q86)
Query Sequence
>Ac3H11_2431 ABC transporter ATP-binding protein
MSNVLRLSHITKRFGKLVANDSISLTLARGEVLALLGENGAGKSTLMSILFGHYVADEGS
IEVFGQPLPPGQPRAALAAGIGMVHQHFTLADNLTVLDNVLLGSEPLWQPFSRRSEARAK
LLAVSQQFGLPVSPDAKVGSLSVGERQRVEILKALYRGAHILILDEPTAVLTPQESEALF
DTLAQMVAQGLSIIFISHKLGEVLRVSHRVAVLRQGKLVAEAPAQGTTQGQLAQWMVGHA
IEAAERRPAQNVGEPICTLSNVSTAPAGRDRLNDVSLTLRAGEIVAIAGVSGNGQVALAD
VLCGVRAATTGQVTLRGAPLQARPAWLVSQGVARIPEDRHAVGVVGDLPVWENAVSERLR
GPWFAHPWFRAFWVKRRAARQHAQRVAETFDVRGGGADAPARSLSGGNMQKLILGRALMP
PQDAAGNSAPVPQLIVAHQPTWGLDIGAVMFVQQQLINARDSGAAVLLISDDLDEVLALG
DRVAVMHDGRLSEALPAEGWTREAIGLAMAGAAH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory