SitesBLAST
Comparing Ac3H11_2518 FitnessBrowser__acidovorax_3H11:Ac3H11_2518 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2b4qA Pseudomonas aeruginosa rhlg/NADP active-site complex (see paper)
39% identity, 97% coverage: 5:259/263 of query aligns to 1:256/256 of 2b4qA
- active site: G20 (= G24), S148 (= S150), V149 (≠ I151), Y162 (= Y166), K166 (= K170)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G20), S18 (= S22), R19 (= R23), I21 (≠ L25), A40 (≠ S44), R41 (= R45), D42 (≠ K46), D65 (= D70), L66 (≠ C71), S67 (≠ A72), N92 (= N97), A93 (= A98), G94 (= G99), I146 (≠ V148), G147 (≠ A149), S148 (= S150), Y162 (= Y166), K166 (= K170), P192 (= P196), G193 (= G197), R194 (≠ F198), F195 (= F199), S197 (= S201), M199 (= M203)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
37% identity, 95% coverage: 8:256/263 of query aligns to 1:248/252 of 1vl8B
- active site: G17 (= G24), S143 (= S150), I154 (≠ T163), Y157 (= Y166), K161 (= K170)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G20), R16 (= R23), G17 (= G24), L18 (= L25), S37 (= S44), R38 (= R45), C63 (≠ A69), D64 (= D70), V65 (≠ C71), A91 (≠ N97), A92 (= A98), G93 (= G99), I94 (≠ A100), V114 (≠ L120), I141 (≠ V148), S143 (= S150), Y157 (= Y166), K161 (= K170), P187 (= P196), G188 (= G197), Y190 (≠ F199), T192 (≠ S201), M194 (= M203), T195 (= T204)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
40% identity, 94% coverage: 11:257/263 of query aligns to 3:245/247 of 4jroC
- active site: G16 (= G24), S142 (= S150), Q152 (≠ G160), Y155 (≠ T163), K159 (= K170)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G20), S14 (= S22), R15 (= R23), G16 (= G24), I17 (≠ L25), N35 (≠ S43), Y36 (≠ S44), N37 (≠ R45), G38 (≠ K46), S39 (≠ A47), N63 (≠ D70), V64 (≠ C71), N90 (= N97), A91 (= A98), I93 (≠ A100), I113 (≠ L120), S142 (= S150), Y155 (≠ T163), K159 (= K170), P185 (= P196), I188 (≠ F199), T190 (≠ S201)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
37% identity, 92% coverage: 17:259/263 of query aligns to 5:244/244 of 1edoA
- active site: G12 (= G24), S138 (= S150), Y151 (= Y166), K155 (= K170)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G20), S10 (= S22), R11 (= R23), I13 (≠ L25), N31 (≠ S43), Y32 (vs. gap), A33 (≠ S44), R34 (= R45), S35 (≠ K46), D59 (= D70), V60 (≠ C71), N86 (= N97), A87 (= A98), S138 (= S150), Y151 (= Y166), K155 (= K170), P181 (= P196), G182 (= G197), I184 (≠ F199), S186 (= S201), M188 (= M203)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
36% identity, 93% coverage: 14:257/263 of query aligns to 5:244/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
37% identity, 93% coverage: 14:257/263 of query aligns to 2:237/239 of 3sj7A
- active site: G12 (= G24), S138 (= S150), Q148 (≠ G160), Y151 (≠ T163), K155 (= K170)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G20), S10 (= S22), R11 (= R23), I13 (≠ L25), N31 (≠ S43), Y32 (≠ S44), A33 (≠ R45), G34 (≠ K46), S35 (≠ A47), A58 (= A69), N59 (≠ D70), V60 (≠ C71), N86 (= N97), A87 (= A98), T109 (≠ L120), S138 (= S150), Y151 (≠ T163), K155 (= K170), P181 (= P196), G182 (= G197)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
36% identity, 94% coverage: 11:257/263 of query aligns to 4:244/247 of P73574
- A14 (≠ G21) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (= P158) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K170) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (= F198) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ G212) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
35% identity, 96% coverage: 8:259/263 of query aligns to 2:257/258 of 3ak4A
- active site: G18 (= G24), S141 (= S150), L151 (≠ G160), Y154 (= Y166), K158 (= K170), E199 (≠ V205)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ R23), G18 (= G24), I19 (≠ L25), D38 (= D49), L39 (= L50), V60 (≠ A69), D61 (= D70), V62 (≠ C71), N88 (= N97), A89 (= A98), G90 (= G99), T139 (≠ V148), S141 (= S150), Y154 (= Y166), K158 (= K170), G185 (= G197), V187 (≠ F199), T189 (≠ S201), M191 (= M203)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
35% identity, 95% coverage: 11:260/263 of query aligns to 3:248/248 of 6ixmC
- active site: G16 (= G24), S142 (= S150), Y155 (= Y166), K159 (= K170)
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), S15 (≠ R23), G16 (= G24), I17 (≠ L25), D36 (≠ S44), I37 (≠ R45), A61 (= A69), D62 (= D70), T63 (≠ C71), N89 (= N97), A90 (= A98), M140 (≠ V148), S142 (= S150), Y155 (= Y166), K159 (= K170), P185 (= P196), A186 (≠ G197), Y187 (≠ F198), I188 (≠ F199), L192 (≠ M203)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
35% identity, 98% coverage: 1:258/263 of query aligns to 5:258/261 of 5u9pB
- active site: G27 (= G24), S152 (= S150), Y165 (= Y166), K169 (= K170)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G20), R26 (= R23), G27 (= G24), I28 (≠ L25), R48 (= R45), D73 (= D70), V74 (≠ C71), N100 (= N97), A101 (= A98), I150 (≠ V148), Y165 (= Y166), K169 (= K170), P195 (= P196), F198 (= F199), T200 (≠ S201), L202 (≠ M203), N203 (≠ T204)
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
36% identity, 94% coverage: 9:256/263 of query aligns to 6:243/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G20), D19 (≠ S22), L22 (= L25), I42 (≠ A47), D65 (= D70), M66 (≠ C71), N92 (= N97), A93 (= A98), G94 (= G99), L115 (= L120), I143 (≠ V148), S145 (= S150), Y158 (= Y166), K162 (= K170), G189 (= G197), M191 (= M203), T193 (≠ V205), N195 (≠ T207)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
37% identity, 94% coverage: 9:256/263 of query aligns to 3:245/249 of 3uf0A
- active site: G18 (= G24), S141 (= S150), V151 (≠ T163), Y154 (= Y166), K158 (= K170)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G20), S17 (≠ R23), G18 (= G24), I19 (≠ L25), R39 (= R45), D63 (= D70), L64 (≠ C71), N89 (= N97), G91 (= G99), I92 (≠ A100), I139 (≠ V148), A140 (= A149), S141 (= S150), Y154 (= Y166), K158 (= K170), P184 (= P196), G185 (= G197), V187 (≠ F199), T189 (≠ S201), N191 (≠ M203), T192 (= T204)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
31% identity, 95% coverage: 8:258/263 of query aligns to 2:253/255 of 5itvA
- active site: G18 (= G24), S141 (= S150), Y154 (= Y166), K158 (= K170)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G20), S17 (≠ R23), G18 (= G24), I19 (≠ L25), D38 (= D49), I39 (≠ L50), T61 (≠ A69), I63 (≠ C71), N89 (= N97), G91 (= G99), T139 (≠ V148), S141 (= S150), Y154 (= Y166), K158 (= K170), P184 (= P196), G185 (= G197), I186 (≠ F198), I187 (≠ F199)
1zemA Crystal structure of NAD+-bound xylitol dehydrogenase (see paper)
34% identity, 94% coverage: 11:256/263 of query aligns to 3:260/260 of 1zemA
- active site: N16 (≠ G24), S142 (= S150), Y155 (= Y166), K159 (= K170), D212 (≠ E213)
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), G15 (≠ R23), N16 (≠ G24), I17 (≠ L25), D36 (≠ S44), M37 (≠ R45), D62 (= D70), V63 (≠ C71), N89 (= N97), A90 (= A98), G91 (= G99), T140 (≠ V148), S142 (= S150), Y155 (= Y166), K159 (= K170), P185 (= P196), M188 (≠ F199)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
34% identity, 97% coverage: 7:260/263 of query aligns to 2:247/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G20), S17 (= S22), R18 (= R23), I20 (≠ L25), T40 (≠ R45), N62 (≠ D70), V63 (≠ C71), N89 (= N97), A90 (= A98), I92 (≠ A100), V139 (= V148), S141 (= S150), Y154 (= Y166), K158 (= K170), P184 (= P196), G185 (= G197), I187 (≠ F199), T189 (≠ S201), M191 (= M203)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
34% identity, 95% coverage: 9:257/263 of query aligns to 4:245/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G20), R18 (= R23), G19 (= G24), I20 (≠ L25), D39 (≠ S44), R40 (= R45), C63 (≠ A69), I65 (≠ C71), N91 (= N97), G93 (= G99), I94 (≠ A100), V114 (≠ L120), Y155 (= Y166), K159 (= K170), I188 (≠ F199), T190 (≠ S201), T193 (= T204)
6j7uA Crystal structure of blue fluorescent protein from metagenomic library in complex with NADPH (see paper)
37% identity, 95% coverage: 10:258/263 of query aligns to 2:246/247 of 6j7uA
- active site: G16 (= G24), S142 (= S150), Y156 (= Y166)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G20), S14 (= S22), R15 (= R23), I17 (≠ L25), Y36 (≠ S44), V37 (≠ R45), S38 (≠ K46), S41 (≠ D49), D65 (= D70), S66 (≠ C71), N92 (= N97), A93 (= A98), G94 (= G99), I115 (≠ L120), G141 (≠ A149), S142 (= S150), Y156 (= Y166), K160 (= K170), P186 (= P196), T191 (≠ S201), M193 (= M203), N194 (≠ T204)
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
35% identity, 95% coverage: 7:257/263 of query aligns to 6:251/254 of 4ag3A
- active site: G23 (= G24), S148 (= S150), Y161 (= Y166), K165 (= K170)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G20), S21 (= S22), R22 (= R23), G23 (= G24), I24 (≠ L25), T44 (≠ R45), L68 (≠ A69), D69 (= D70), V70 (≠ C71), N96 (= N97), A97 (= A98), I146 (≠ V148), S148 (= S150), Y161 (= Y166), K165 (= K170), P191 (= P196), G192 (= G197), F193 (= F198), I194 (≠ F199), T196 (≠ S201), M198 (= M203), T199 (= T204)
4bnzA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-methyl-n-phenylindole- 3-carboxamide at 2.5a resolution (see paper)
35% identity, 95% coverage: 7:257/263 of query aligns to 1:238/241 of 4bnzA
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
37% identity, 95% coverage: 9:257/263 of query aligns to 1:237/240 of 4dmmB
- active site: G16 (= G24), S142 (= S150), Q152 (≠ G160), Y155 (= Y166), K159 (= K170)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G20), S14 (= S22), R15 (= R23), G16 (= G24), I17 (≠ L25), A37 (≠ S44), S38 (≠ R45), S39 (≠ K46), A62 (= A69), D63 (= D70), V64 (≠ C71), N90 (= N97), A91 (= A98), L113 (= L120), I140 (≠ V148), S142 (= S150), Y155 (= Y166), K159 (= K170), P185 (= P196), G186 (= G197), I188 (≠ F199), T190 (≠ S201), M192 (= M203)
Query Sequence
>Ac3H11_2518 FitnessBrowser__acidovorax_3H11:Ac3H11_2518
MTRTIQQLFDLTGKTALVTGGSRGLGLQLAHALGEAGAKIMLSSRKASDLEEATAELQAA
GIDARWIAADCANETDIRRLADETLECLGHVDILINNAGAAWGAPAEDHPVDAWDKVMNL
NVRGYFILSQHIAKHSMIGRRSGSIINVASIAGLGGNPKGMNTIAYNTSKGAVINFTRAL
AAEWGAYNIRVNAICPGFFPSKMTVGTLKAMGEEALAAHAPLGRLGDDEDLKGLCALYAS
DAGKHITGQWLAVDGGVSIVTGG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory