SitesBLAST
Comparing Ac3H11_2525 FitnessBrowser__acidovorax_3H11:Ac3H11_2525 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
32% identity, 90% coverage: 12:246/261 of query aligns to 4:234/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (= F19), V16 (≠ I24), S36 (≠ N44), G37 (= G45), S38 (≠ A46), G39 (= G47), K40 (= K48), S41 (= S49), T42 (= T50), E162 (= E178), H194 (= H209)
- binding magnesium ion: S41 (= S49), E162 (= E178)
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 92% coverage: 10:250/261 of query aligns to 5:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 93% coverage: 10:251/261 of query aligns to 5:254/254 of 1g6hA
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
31% identity, 87% coverage: 9:235/261 of query aligns to 2:217/374 of 2awnB
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
31% identity, 87% coverage: 9:235/261 of query aligns to 3:218/371 of P68187
- A85 (≠ N94) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ Y115) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ A133) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ L136) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (= E138) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ D143) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (≠ A156) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D177) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
31% identity, 87% coverage: 9:235/261 of query aligns to 2:217/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F19), S37 (≠ N44), G38 (= G45), C39 (≠ A46), G40 (= G47), K41 (= K48), S42 (= S49), T43 (= T50), Q81 (= Q91), R128 (≠ T148), A132 (≠ N152), S134 (≠ T154), G136 (≠ A156), Q137 (≠ E157), E158 (= E178), H191 (= H209)
- binding magnesium ion: S42 (= S49), Q81 (= Q91)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
31% identity, 87% coverage: 9:235/261 of query aligns to 2:217/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F19), G38 (= G45), C39 (≠ A46), G40 (= G47), K41 (= K48), S42 (= S49), T43 (= T50), R128 (≠ T148), S134 (≠ T154), Q137 (≠ E157)
- binding beryllium trifluoride ion: S37 (≠ N44), G38 (= G45), K41 (= K48), Q81 (= Q91), S134 (≠ T154), G136 (≠ A156), H191 (= H209)
- binding magnesium ion: S42 (= S49), Q81 (= Q91)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
31% identity, 87% coverage: 9:235/261 of query aligns to 2:217/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F19), V17 (≠ I24), G38 (= G45), C39 (≠ A46), G40 (= G47), K41 (= K48), S42 (= S49), T43 (= T50), R128 (≠ T148), A132 (≠ N152), S134 (≠ T154), Q137 (≠ E157)
- binding tetrafluoroaluminate ion: S37 (≠ N44), G38 (= G45), K41 (= K48), Q81 (= Q91), S134 (≠ T154), G135 (≠ Y155), G136 (≠ A156), E158 (= E178), H191 (= H209)
- binding magnesium ion: S42 (= S49), Q81 (= Q91)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
31% identity, 87% coverage: 9:235/261 of query aligns to 2:217/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F19), V17 (≠ I24), G38 (= G45), C39 (≠ A46), G40 (= G47), K41 (= K48), S42 (= S49), T43 (= T50), R128 (≠ T148), A132 (≠ N152), S134 (≠ T154), Q137 (≠ E157)
- binding magnesium ion: S42 (= S49), Q81 (= Q91)
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
31% identity, 87% coverage: 10:235/261 of query aligns to 1:215/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F19), S35 (≠ N44), G36 (= G45), C37 (≠ A46), G38 (= G47), K39 (= K48), S40 (= S49), T41 (= T50), R126 (≠ T148), A130 (≠ N152), S132 (≠ T154), G134 (≠ A156), Q135 (≠ E157)
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
31% identity, 87% coverage: 9:235/261 of query aligns to 3:218/369 of P19566
- L86 (≠ I95) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P179) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (≠ E187) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
29% identity, 92% coverage: 10:250/261 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
29% identity, 92% coverage: 10:250/261 of query aligns to 3:235/238 of 6s8gA
- binding phosphoaminophosphonic acid-adenylate ester: Y12 (≠ F19), R15 (≠ T22), N37 (= N44), G40 (= G47), K41 (= K48), T42 (≠ S49), T43 (= T50), Q84 (= Q91), S136 (≠ N152), S138 (≠ T154), E141 (= E157)
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
29% identity, 92% coverage: 10:250/261 of query aligns to 3:235/235 of 6mhzA
- binding adp orthovanadate: Y12 (≠ F19), N37 (= N44), G38 (= G45), G40 (= G47), K41 (= K48), T42 (≠ S49), T43 (= T50), Q84 (= Q91), S136 (≠ N152), S138 (≠ T154), G139 (≠ Y155), G140 (≠ A156), E162 (= E178), G166 (= G182), H194 (= H209)
Q8R420 Phospholipid-transporting ATPase ABCA3; ATP-binding cassette sub-family A member 3; Xenobiotic-transporting ATPase ABCA3; EC 7.6.2.1; EC 7.6.2.2 from Mus musculus (Mouse) (see paper)
34% identity, 79% coverage: 25:229/261 of query aligns to 549:741/1704 of Q8R420
Sites not aligning to the query:
- 292 E→V: Knockin new born mice are healthy and survive into adulthood without overt signs of respiratory distress. Knockin mice show a severe lung phenotype that begins with alveolar inflammatory cell infiltration at the early stage of the mouse life followed by aberrant lung remodeling with characteristics of diffuse parenchymal lung disease (DPLD)- and emphysema-like alveolar disruption in older mice.
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
28% identity, 85% coverage: 10:231/261 of query aligns to 5:221/501 of P04983
- K43 (= K48) mutation to R: Loss of transport.
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
27% identity, 93% coverage: 10:253/261 of query aligns to 3:240/241 of 4u00A
6mbnA Lptb e163q in complex with atp (see paper)
29% identity, 92% coverage: 10:250/261 of query aligns to 4:236/241 of 6mbnA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
29% identity, 92% coverage: 10:250/261 of query aligns to 3:235/240 of 6mjpA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
29% identity, 92% coverage: 10:249/261 of query aligns to 3:234/234 of 6b89A
- binding adenosine-5'-diphosphate: Y12 (≠ F19), R15 (≠ T22), V17 (≠ I24), N37 (= N44), G38 (= G45), G40 (= G47), K41 (= K48), T42 (≠ S49), T43 (= T50)
- binding magnesium ion: T42 (≠ S49), Q84 (= Q91)
- binding novobiocin: L71 (≠ P78), H72 (≠ Y79), P83 (≠ F90), A86 (≠ T93), S87 (≠ N94), F89 (= F96), R90 (≠ P97), R91 (≠ K98), L92 (= L99), V101 (= V109), Q135 (≠ M151), R149 (≠ I165)
Query Sequence
>Ac3H11_2525 FitnessBrowser__acidovorax_3H11:Ac3H11_2525
MAADNATYALELRDLRKSFGKTEIIRGANLAVAPGERVAIIGPNGAGKSTLFNLISGRFA
PTSGDVILNGQRINGMAPYEINRRGLSRSFQITNIFPKLSVFENLRCGVLWSMGYKYTFL
RFLSNLHDANERAKQLMEMIKLDKKRDTLAMNLTYAEQRALEIGITIAGGANVILLDEPT
AGMSKTETTRFIHLIKEVTEGRTLLTVEHDMGVVFGLADKIAVVVYGEVIAFDTPEKVRA
NQRVQEAYLGSVVADEQGAGH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory