SitesBLAST
Comparing Ac3H11_2529 FitnessBrowser__acidovorax_3H11:Ac3H11_2529 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0DX84 3-methylmercaptopropionyl-CoA ligase; MMPA-CoA ligase; EC 6.2.1.44 from Ruegeria lacuscaerulensis (strain DSM 11314 / KCTC 2953 / ITI-1157) (Silicibacter lacuscaerulensis) (see paper)
55% identity, 99% coverage: 1:541/547 of query aligns to 1:535/539 of P0DX84
- H231 (= H232) mutation to A: Retains 74% of wild-type activity.
- W235 (= W236) mutation to A: Almost completely abolishes the activity.
- G302 (= G303) mutation to P: Almost completely abolishes the activity.
- G303 (= G304) mutation to P: Almost completely abolishes the activity.
- W326 (= W327) mutation to A: Retains 7.7% of wild-type activity.
- P333 (= P334) mutation to A: Retains 69% of wild-type activity.
- R432 (= R438) mutation to A: Retains 4.3% of wild-type activity.
- K434 (= K440) mutation to A: Retains 36% of wild-type activity.
- D435 (= D441) mutation to A: Retains 76% of wild-type activity.
- K438 (= K444) mutation to A: Retains 5.6% of wild-type activity.
- G440 (= G446) mutation to P: Retains 3.6% of wild-type activity.
- G441 (= G447) mutation to P: Retains 2.7% of wild-type activity.
- E442 (= E448) mutation to A: Retains 27% of wild-type activity.
- W443 (= W449) mutation to A: Retains 60% of wild-type activity.
- E474 (= E480) mutation to A: Retains 33% of wild-type activity.
- K523 (= K529) Plays an important role in catalysis; mutation to A: Retains 1.6% of wild-type activity.; mutation to E: Retains 1.4% of wild-type activity.; mutation to R: Retains 57% of wild-type activity.
- K526 (= K532) mutation to A: Retains 48% of wild-type activity.
6ijbB Structure of 3-methylmercaptopropionate coa ligase mutant k523a in complex with amp and mmpa (see paper)
55% identity, 99% coverage: 1:541/547 of query aligns to 1:535/538 of 6ijbB
- active site: T185 (= T186), H205 (= H206), H231 (= H232), S329 (≠ T330), E330 (= E331), K438 (= K444), W443 (= W449), A523 (≠ K529)
- binding 3-(methylsulfanyl)propanoic acid: W235 (= W236), G303 (= G304), A325 (= A326), W326 (= W327), G327 (= G328), M328 (= M329)
- binding adenosine monophosphate: G303 (= G304), A304 (≠ S305), A305 (= A306), H324 (= H325), W326 (= W327), G327 (= G328), M328 (= M329), S329 (≠ T330), Q359 (= Q360), D417 (= D423)
6ihkB Structure of mmpa coa ligase in complex with adp (see paper)
55% identity, 99% coverage: 1:541/547 of query aligns to 1:532/533 of 6ihkB
- active site: T185 (= T186), H202 (= H206), H228 (= H232), S326 (≠ T330), E327 (= E331), K435 (= K444), W440 (= W449), K520 (= K529)
- binding adenosine-5'-diphosphate: H228 (= H232), G300 (= G304), A301 (≠ S305), A302 (= A306), H321 (= H325), A322 (= A326), W323 (= W327), G324 (= G328), M325 (= M329), S326 (≠ T330), Q356 (= Q360), D414 (= D423), R429 (= R438), K520 (= K529)
Q5SKN9 Long-chain-fatty-acid--CoA ligase; Long-chain fatty acyl-CoA synthetase; LC-FACS; EC 6.2.1.3 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
45% identity, 98% coverage: 5:542/547 of query aligns to 13:537/541 of Q5SKN9
- T184 (= T186) binding
- G302 (= G304) binding
- Q322 (≠ H325) binding
- G323 (≠ A326) binding
- T327 (= T330) binding
- E328 (= E331) binding
- D418 (= D423) binding
- K435 (= K440) binding
- K439 (= K444) binding
1v26B Crystal structure of tt0168 from thermus thermophilus hb8 (see paper)
43% identity, 98% coverage: 5:542/547 of query aligns to 6:506/510 of 1v26B
- active site: T177 (= T186), H197 (= H206), H223 (= H232), T320 (= T330), E321 (= E331), K432 (= K444), W437 (= W449)
- binding adenosine monophosphate: G295 (= G304), S296 (= S305), A297 (= A306), G316 (≠ A326), Y317 (≠ W327), G318 (= G328), L319 (≠ M329), T320 (= T330), D411 (= D423), K428 (= K440), K432 (= K444), W437 (= W449)
- binding magnesium ion: T177 (= T186), E321 (= E331)
1v25A Crystal structure of tt0168 from thermus thermophilus hb8 (see paper)
42% identity, 98% coverage: 5:542/547 of query aligns to 6:487/491 of 1v25A
- active site: T177 (= T186), H197 (= H206), H223 (= H232), T320 (= T330), E321 (= E331), K432 (= K444), W437 (= W449)
- binding phosphoaminophosphonic acid-adenylate ester: H223 (= H232), V224 (= V233), G295 (= G304), S296 (= S305), A297 (= A306), Y317 (≠ W327), G318 (= G328), L319 (≠ M329), T320 (= T330), D411 (= D423), I423 (= I435), K432 (= K444), W437 (= W449)
- binding magnesium ion: T177 (= T186), E321 (= E331)
8i3iA Acyl-acp synthetase structure bound to amp-pnp
35% identity, 97% coverage: 10:537/547 of query aligns to 10:519/522 of 8i3iA
- binding phosphoaminophosphonic acid-adenylate ester: T172 (= T186), G174 (= G188), T175 (= T189), T176 (= T190), K180 (= K194), G293 (= G304), A294 (≠ S305), A295 (= A306), Y315 (≠ W327), M317 (= M329), S318 (≠ T330), D408 (= D423), R423 (= R438)
8i8eA Acyl-acp synthetase structure bound to c18:1-acp
35% identity, 97% coverage: 10:537/547 of query aligns to 10:527/530 of 8i8eA
- binding adenosine monophosphate: G292 (= G303), G293 (= G304), A294 (≠ S305), A295 (= A306), G314 (≠ A326), Y315 (≠ W327), M317 (= M329), S318 (≠ T330), D408 (= D423), R423 (= R438)
- binding 4'-phosphopantetheine: R93 (= R97), P220 (= P229), H223 (= H232)
8i49A Acyl-acp synthetase structure bound to atp
35% identity, 97% coverage: 10:537/547 of query aligns to 10:527/530 of 8i49A
8i22A Acyl-acp synthetase structure bound to pimelic acid monoethyl ester
35% identity, 97% coverage: 10:537/547 of query aligns to 10:527/530 of 8i22A
8i8dA Acyl-acp synthetase structure bound to mc7-acp
35% identity, 97% coverage: 10:537/547 of query aligns to 10:527/529 of 8i8dA
- binding adenosine monophosphate: G292 (= G303), G293 (= G304), A295 (= A306), G314 (≠ A326), Y315 (≠ W327), G316 (= G328), M317 (= M329), S318 (≠ T330), D408 (= D423), K429 (= K444)
- binding 7-methoxy-7-oxidanylidene-heptanoic acid: H223 (= H232), W227 (= W236), G292 (= G303), G316 (= G328), P322 (= P334)
- binding N~3~-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-N-(2-sulfanylethyl)-beta-alaninamide: R93 (= R97), P220 (= P229), H223 (= H232), I269 (≠ V279), G432 (= G447)
8i6mA Acyl-acp synthetase structure bound to amp-c18:1
35% identity, 97% coverage: 10:537/547 of query aligns to 8:525/528 of 8i6mA
- binding adenosine monophosphate: G291 (= G304), A293 (= A306), G312 (≠ A326), Y313 (≠ W327), G314 (= G328), M315 (= M329), S316 (≠ T330), D406 (= D423), R421 (= R438)
- binding magnesium ion: M315 (= M329), S316 (≠ T330), E317 (= E331)
8i51A Acyl-acp synthetase structure bound to amp-mc7
35% identity, 97% coverage: 10:537/547 of query aligns to 8:525/528 of 8i51A
- binding adenosine monophosphate: G291 (= G304), A293 (= A306), Y313 (≠ W327), M315 (= M329), S316 (≠ T330), D406 (= D423), R421 (= R438)
- binding 7-methoxy-7-oxidanylidene-heptanoic acid: W225 (= W236), G290 (= G303), G312 (≠ A326), G314 (= G328), M315 (= M329), P320 (= P334), I321 (≠ L335)
P9WQ37 Long-chain-fatty-acid--CoA ligase FadD13; Fatty acyl-CoA ligase; FACL; FACL13; Fatty acyl-CoA synthetase; ACS; FACS; Very-long-chain fatty-acyl-CoA synthetase; ACSVL; EC 6.2.1.3 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 4 papers)
29% identity, 91% coverage: 39:538/547 of query aligns to 29:496/503 of P9WQ37
- K172 (= K194) mutation to A: Slight reduction of the fatty acyl-CoA ligase activity. Slight increase of susceptibility to proteolysis.
- R195 (≠ S219) mutation to A: Alteration of the strength of the membrane binding; when associated with A-9; A-17; A-197 and A-244.
- R197 (= R221) mutation to A: Alteration of the strength of the membrane binding; when associated with A-9; A-17; A-195 and A-244.
- V209 (= V233) mutation to D: Strong reduction of the fatty acyl-CoA ligase activity. No significant change in the total expression level, however the cytoplasmic expression is reduced. Slight increase of susceptibility to proteolysis.
- A211 (= A235) mutation to G: Slight increase of the fatty acyl-CoA ligase activity. Reduced rate of proteolytic degradation.
- T214 (≠ I238) mutation to W: Shows a marked decrease in the activity with lauric and palmitic acid (C12 and C16 fatty acid) with a simultaneous increase in the activity with caprylic acid (C8 fatty acid).
- R244 (≠ K269) mutation to A: Alteration of the strength of the membrane binding; when associated with A-17; A-195; A-195 and A-197.
- A302 (≠ G328) mutation to G: Slight increase of the fatty acyl-CoA ligase activity. Reduced rate of proteolytic degradation.; mutation to W: Does not show activity with small, medium or long acyl chains.
- W377 (= W418) mutation to A: Strong reduction of the fatty acyl-CoA ligase activity. Enhanced affinity towards palmitic acid binding. No significant change in the total expression level, however the cytoplasmic expression is low. Slight increase of susceptibility to proteolysis.
- D382 (= D423) mutation to A: Strong reduction of the fatty acyl-CoA ligase activity. No significant change in the total expression level, however the cytoplasmic expression is reduced.
- R397 (= R438) mutation to A: Reduction of binding affinity for fatty acids.
- S404 (= S445) mutation to A: Slight reduction of the fatty acyl-CoA ligase activity. Enhanced affinity towards palmitic acid binding.
- G406 (= G447) mutation to L: No effect on the formation of acyl-adenylate intermediate. However, it shows very poor catalytic efficiency to form acyl-CoA.
- K487 (= K529) mutation to A: Strong reduction of the fatty acyl-CoA ligase activity. Reduction of binding affinity for ATP.
Sites not aligning to the query:
- 9 R→A: Alteration of the strength of the membrane binding; when associated with A-9; A-195; A-197 and A-244.
- 17 R→A: Alteration of the strength of the membrane binding; when associated with A-9; A-17; A-197 and A-244.
3r44A Mycobacterium tuberculosis fatty acyl coa synthetase (see paper)
28% identity, 91% coverage: 39:538/547 of query aligns to 32:496/502 of 3r44A
Sites not aligning to the query:
Q4WR83 Acyl-CoA ligase sidI; Siderophore biosynthesis protein I; EC 6.2.1.- from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
28% identity, 91% coverage: 39:537/547 of query aligns to 64:571/590 of Q4WR83
Sites not aligning to the query:
- 6:14 PTS2-type peroxisomal targeting signal
4wv3B Crystal structure of the anthranilate coa ligase auaeii in complex with anthranoyl-amp (see paper)
25% identity, 91% coverage: 41:540/547 of query aligns to 37:513/518 of 4wv3B
- active site: S175 (≠ T186), T320 (= T330), E321 (= E331), K418 (= K444), W423 (= W449), K502 (= K529)
- binding 5'-O-[(S)-[(2-aminobenzoyl)oxy](hydroxy)phosphoryl]adenosine: F220 (≠ H232), T221 (≠ V233), F222 (≠ N234), A293 (≠ G303), S294 (≠ G304), E295 (≠ S305), A296 (= A306), G316 (≠ A326), I317 (≠ W327), G318 (= G328), C319 (≠ M329), T320 (= T330), D397 (= D423), H409 (≠ I435), R412 (= R438), K502 (= K529)
P69451 Long-chain-fatty-acid--CoA ligase; Long-chain acyl-CoA synthetase; Acyl-CoA synthetase; EC 6.2.1.3 from Escherichia coli (strain K12) (see paper)
25% identity, 91% coverage: 41:540/547 of query aligns to 50:554/561 of P69451
- Y213 (= Y185) mutation to A: Loss of activity.
- T214 (= T186) mutation to A: 10% of wild-type activity.
- G216 (= G188) mutation to A: Decreases activity.
- T217 (= T189) mutation to A: Decreases activity.
- G219 (= G191) mutation to A: Decreases activity.
- K222 (= K194) mutation to A: Decreases activity.
- E361 (= E331) mutation to A: Loss of activity.
3ni2A Crystal structures and enzymatic mechanisms of a populus tomentosa 4- coumarate:coa ligase (see paper)
26% identity, 95% coverage: 22:538/547 of query aligns to 30:528/528 of 3ni2A
- active site: S182 (≠ T186), S202 (≠ T204), H230 (= H232), T329 (= T330), E330 (= E331), K434 (= K444), Q439 (≠ W449), K519 (= K529)
- binding 5'-O-{(S)-hydroxy[3-(4-hydroxyphenyl)propoxy]phosphoryl}adenosine: Y232 (≠ N234), S236 (= S241), G302 (= G304), A303 (≠ S305), P304 (≠ A306), G325 (≠ A326), G327 (= G328), T329 (= T330), P333 (= P334), V334 (≠ L335), D413 (= D423), K430 (= K440), K434 (= K444), Q439 (≠ W449)
3a9vA Crystal structures and enzymatic mechanisms of a populus tomentosa 4- coumarate--coa ligase (see paper)
26% identity, 95% coverage: 22:538/547 of query aligns to 30:528/528 of 3a9vA
- active site: S182 (≠ T186), S202 (≠ T204), H230 (= H232), T329 (= T330), E330 (= E331), K434 (= K444), Q439 (≠ W449), K519 (= K529)
- binding adenosine monophosphate: H230 (= H232), G302 (= G304), A303 (≠ S305), P304 (≠ A306), Y326 (≠ W327), G327 (= G328), M328 (= M329), T329 (= T330), D413 (= D423), K430 (= K440), K434 (= K444), Q439 (≠ W449)
Query Sequence
>Ac3H11_2529 FitnessBrowser__acidovorax_3H11:Ac3H11_2529
MLGLMQSQPLLISSLIEFAERHHGDAEIVSRRVEGDIHRYTYRDLAARARRLANALDDLQ
LQFSDRVATLAWNGYRHMEMYFGVSGSGRVLHTVNPRLHPDQIAWIVNHAEDQVLCFDLT
FLPLVQAVHAKCPTVKKWVALCDADKLPADSGVPGLSSYEDWIGAHSADYAWPEFDENSA
SSMCYTSGTTGNPKAALYSHRSTTLHAYAAALPDVMCLSARDSVLPVVPMFHVNAWGIPY
SAALTGCKLVFPGPAMDGKSIYELIESEKVSYAAGVPTVWQMMLGHMKPAGLKFSTLKRT
VIGGSACPPAMIHAFKEDYGVEVLHAWGMTEMSPLGTLCTLKNKHLSLPKDEQMKVLLKQ
GRAIYGVDMKIVGGDGEELPWDGKTYGDLLVKGPWIVDSYFKGEGGHPLVKDKQGRGWFP
TGDVATIDADGFMQITDRSKDVIKSGGEWISSIDIENIAMAHPAIAMAACVGMPHPKWDE
RPIVAVVKRPGTEVTRDELLAFYEGKTAKWQIPDDVVFVDAIPLGATGKMLKTKLREQLK
DYKLPGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory