Comparing Ac3H11_2555 FitnessBrowser__acidovorax_3H11:Ac3H11_2555 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
44% identity, 87% coverage: 29:244/249 of query aligns to 6:224/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
45% identity, 87% coverage: 29:244/249 of query aligns to 6:226/226 of 4zv1A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
44% identity, 86% coverage: 29:243/249 of query aligns to 12:228/229 of 5t0wA
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
39% identity, 88% coverage: 26:243/249 of query aligns to 2:221/226 of 8eyzA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
40% identity, 87% coverage: 29:245/249 of query aligns to 12:229/229 of 6svfA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
40% identity, 87% coverage: 28:243/249 of query aligns to 2:222/224 of 4ymxA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
37% identity, 86% coverage: 31:243/249 of query aligns to 5:220/231 of 2q2cA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
37% identity, 86% coverage: 31:243/249 of query aligns to 15:230/241 of 2q2aA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
37% identity, 86% coverage: 31:243/249 of query aligns to 9:224/235 of 2pvuA
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
34% identity, 86% coverage: 31:244/249 of query aligns to 18:235/235 of 4g4pA
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
32% identity, 87% coverage: 29:244/249 of query aligns to 8:228/228 of 2y7iA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
34% identity, 87% coverage: 29:244/249 of query aligns to 15:231/237 of 3vv5A
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
34% identity, 87% coverage: 29:244/249 of query aligns to 19:235/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
34% identity, 87% coverage: 29:244/249 of query aligns to 19:235/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
34% identity, 87% coverage: 29:244/249 of query aligns to 19:235/241 of 3vvdA
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
33% identity, 86% coverage: 29:243/249 of query aligns to 28:253/260 of P02910
Sites not aligning to the query:
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
33% identity, 86% coverage: 29:243/249 of query aligns to 6:231/238 of 1hslA
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
33% identity, 86% coverage: 29:243/249 of query aligns to 28:253/260 of P0AEU0
Sites not aligning to the query:
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
32% identity, 87% coverage: 27:243/249 of query aligns to 1:228/235 of 5owfA
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
32% identity, 87% coverage: 27:243/249 of query aligns to 26:253/260 of P02911
>Ac3H11_2555 FitnessBrowser__acidovorax_3H11:Ac3H11_2555
MNLRRNLLLASLAAAAFCTTGAQAQDNVLRVGTDATFPPMEFVENGKRTGFDIELVEAIA
KTMGKQVEWVDIDFKGLIPGLISKRFDMAVSAIYITDERKKVVDFTDSYYAGGLVVMVKA
DNKAINKLADLDGKKVSVQVGTKSVSYLTEKFPKVQRVEVEKNQEMFNLVDIGRADAAVT
GKPAAFQYVRTRPGLRVLDEQLTTEEYGMALRKDTPELTKAVNGAITKLKADGTYAAIVK
KWFSNSAAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory