Comparing Ac3H11_2594 FitnessBrowser__acidovorax_3H11:Ac3H11_2594 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
Q5ZC82 Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG; Protein LONELY GUY; EC 3.2.2.n1 from Oryza sativa subsp. japonica (Rice) (see paper)
33% identity, 41% coverage: 145:261/287 of query aligns to 74:190/242 of Q5ZC82
Sites not aligning to the query:
P48636 Cytokinin riboside 5'-monophosphate phosphoribohydrolase; AMP nucleosidase; PaLOG; EC 3.2.2.n1; EC 3.2.2.4 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
36% identity, 31% coverage: 196:284/287 of query aligns to 92:181/195 of P48636
Sites not aligning to the query:
5zbkA Crystal structure of type-i log from pseudomonas aeruginosa pao1 in complex with amp (see paper)
34% identity, 31% coverage: 196:284/287 of query aligns to 91:180/182 of 5zbkA
Sites not aligning to the query:
>Ac3H11_2594 FitnessBrowser__acidovorax_3H11:Ac3H11_2594
MEANTQLNERRLADAWAELHNHATNGNPLQADAYRMAFADPEFLFRRETRGIRFQLEMLK
PDLGQTEQGIENTIVVFGSARFMAPEDAAQALTAAEATGDATQIARARLAVRNARHYDLA
REFSRLVAQYSNGKPESERLYICTGGGPGIMEAANRGAHDEGALNVGLNIALPHEQSGNR
YITPSLSFKFHYFALRKMHFMMRAKALVAFPGGFGTLDELFEVLTLVQTGKAKPVPIVLC
GTDYWKRLINFDVLVEEGTISAQDLKLFHYTDDPQEAWDLIRAFYKL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory