SitesBLAST
Comparing Ac3H11_2606 FitnessBrowser__acidovorax_3H11:Ac3H11_2606 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4xgnA Crystal structure of 3-hydroxyacyl-coa dehydrogenase in complex with NAD from burkholderia thailandensis
72% identity, 100% coverage: 1:252/252 of query aligns to 4:255/255 of 4xgnA
- active site: Y161 (= Y158), K165 (= K162)
- binding nicotinamide-adenine-dinucleotide: G15 (= G12), S18 (= S15), G19 (= G16), L20 (= L17), D39 (= D36), L40 (≠ M37), C59 (= C56), D60 (= D57), V61 (= V58), C86 (= C83), A87 (= A84), V113 (= V110), T146 (= T143), Y161 (= Y158), K165 (= K162), P191 (= P188), I193 (= I190), F194 (= F191), T196 (= T193), M198 (= M195)
4o5oB X-ray crystal structure of a 3-hydroxyacyl-coa dehydrogenase from brucella suis
62% identity, 100% coverage: 1:252/252 of query aligns to 7:261/261 of 4o5oB
Sites not aligning to the query:
O18404 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-hydroxysteroid dehydrogenase 10; 17-beta-HSD 10; 3-hydroxyacyl-CoA dehydrogenase type II; Hydroxysteroid dehydrogenase; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Scully protein; Type II HADH; EC 1.1.1.35; EC 1.1.1.51; EC 1.1.1.62; EC 1.1.1.-; EC 1.1.1.53 from Drosophila melanogaster (Fruit fly) (see paper)
56% identity, 99% coverage: 3:251/252 of query aligns to 2:255/255 of O18404
- L33 (≠ I34) mutation to Q: Lethal allele.
- F120 (= F116) mutation to I: Lethal allele.
1u7tA Crystal structure of abad/hsd10 with a bound inhibitor (see paper)
57% identity, 99% coverage: 3:251/252 of query aligns to 2:255/255 of 1u7tA
- active site: G15 (= G16), N115 (= N111), T147 (= T143), S149 (= S145), Y162 (= Y158), K166 (= K162), F195 (= F191)
- binding 1-azepan-1-yl-2-phenyl-2-(4-thioxo-1,4-dihydro-pyrazolo[3,4-d]pyrimidin-5-yl)ethanone adduct: G11 (= G12), S14 (= S15), G15 (= G16), L16 (= L17), D35 (= D36), L36 (≠ M37), D58 (= D57), V59 (= V58), C85 (= C83), A86 (= A84), G87 (= G85), A89 (= A87), V90 (≠ P88), A91 (= A89), T147 (= T143), S149 (= S145), Q156 (= Q152), Q159 (= Q155), Y162 (= Y158), K166 (= K162), P192 (= P188), L194 (≠ I190), F195 (= F191), T197 (= T193), L199 (≠ M195), L200 (= L196), L203 (≠ M199)
1e3wD Rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh and 3-keto butyrate (see paper)
56% identity, 99% coverage: 2:251/252 of query aligns to 1:255/255 of 1e3wD
- active site: G15 (= G16), N115 (= N111), T147 (= T143), S149 (= S145), Y162 (= Y158), K166 (= K162), F195 (= F191)
- binding acetoacetic acid: Y162 (= Y158), T202 (≠ G198)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), S14 (= S15), G15 (= G16), L16 (= L17), D35 (= D36), V36 (≠ M37), N58 (≠ D57), V59 (= V58), C85 (= C83), A86 (= A84), G87 (= G85), V114 (= V110), T147 (= T143), Y162 (= Y158), K166 (= K162), P192 (= P188), L194 (≠ I190), F195 (= F191), T197 (= T193), L199 (≠ M195)
O70351 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-estradiol 17-dehydrogenase; 2-methyl-3-hydroxybutyryl-CoA dehydrogenase; MHBD; 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; 3alpha(or 20beta)-hydroxysteroid dehydrogenase; 7-alpha-hydroxysteroid dehydrogenase; Endoplasmic reticulum-associated amyloid beta-peptide-binding protein; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Short chain dehydrogenase/reductase family 5C member 1; Short-chain type dehydrogenase/reductase XH98G2; Type II HADH; EC 1.1.1.35; EC 1.1.1.62; EC 1.1.1.239; EC 1.1.1.178; EC 1.1.1.53; EC 1.1.1.159 from Rattus norvegicus (Rat) (see paper)
56% identity, 99% coverage: 2:251/252 of query aligns to 7:261/261 of O70351
- S155 (= S145) binding
- Y168 (= Y158) active site, Proton acceptor
7onuC Structure of human mitochondrial rnase p in complex with mitochondrial pre-tRNA-tyr (see paper)
57% identity, 99% coverage: 3:251/252 of query aligns to 2:255/255 of 7onuC
- binding nicotinamide-adenine-dinucleotide: S14 (= S15), G15 (= G16), L16 (= L17), D35 (= D36), L36 (≠ M37), V59 (= V58), C85 (= C83), S149 (= S145), Y162 (= Y158), F195 (= F191), T197 (= T193)
- binding : S92 (≠ E90), K93 (= K91)
Q99714 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-estradiol 17-dehydrogenase; 2-methyl-3-hydroxybutyryl-CoA dehydrogenase; MHBD; 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; 3alpha(or 20beta)-hydroxysteroid dehydrogenase; 7-alpha-hydroxysteroid dehydrogenase; Endoplasmic reticulum-associated amyloid beta-peptide-binding protein; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Short chain dehydrogenase/reductase family 5C member 1; Short-chain type dehydrogenase/reductase XH98G2; Type II HADH; EC 1.1.1.35; EC 1.1.1.62; EC 1.1.1.239; EC 1.1.1.178; EC 1.1.1.53; EC 1.1.1.159 from Homo sapiens (Human) (see 14 papers)
57% identity, 99% coverage: 3:251/252 of query aligns to 8:261/261 of Q99714
- V12 (= V7) to L: in HSD10MD; decreased dehydrogenase activity; decreased tRNA methylation; decreased mitochondrial tRNA 5'-end processing
- S20 (= S15) binding ; mutation to F: Decreased dehydrogenase activity. Does not affect mitochondrial tRNA 5'-end processing. Does not affect tRNA methylation.
- L22 (= L17) binding
- D41 (= D36) binding
- D64 (= D57) binding
- V65 (= V58) binding ; to A: in HSD10MD; uncertain significance; dbSNP:rs104886492
- D86 (≠ M78) to G: in HSD10MD; decreased 3-hydroxy-2-methylbutyryl-CoA dehydrogenase activity; no effect on NAD(+) binding; complete loss of phospholipase C-like activity toward cardiolipin; dbSNP:rs587777651
- C91 (= C83) binding
- R130 (= R120) to C: in HSD10MD; decreased stability; decreased 3-hydroxy-2-methylbutyryl-CoA dehydrogenase activity; decreased mitochondrial tRNA 5'-end processing; decreased tRNA methylation; does not affect homotetramerization; complete loss of phospholipase C-like activity toward cardiolipin; dbSNP:rs28935475
- S155 (= S145) binding
- Q165 (= Q155) to H: in HSD10MD; loss of 3-hydroxy-2-methylbutyryl-CoA dehydrogenase activity; does not bind NAD(+); complete loss of phospholipase C-like activity toward cardiolipin
- Y168 (= Y158) active site, Proton acceptor; binding
- K172 (= K162) binding ; mutation to A: Abolishes dehydrogenase activity. Does not affect mitochondrial tRNA 5'-end processing. Does not affect tRNA methylation. Does not affect homotetramerization.
- V176 (= V166) to M: in HSD10MD; decreased dehydrogenase activity; strongly decreased tRNA methylation; strongly decreased mitochondrial tRNA 5'-end processing
- F201 (= F191) binding
- T203 (= T193) binding
- P210 (= P200) to S: in HSD10MD; decreased 3-hydroxyacyl-CoA dehydrogenase activity; decreased mitochondrial tRNA 5'-end processing; decreased tRNA methylation; does not affect homotetramerization
- K212 (≠ E202) to E: in HSD10MD; 4-fold decrease of 3-hydroxyacyl-CoA dehydrogenase activity; decreased interaction with TRMT10C; decreased function in mitochondrial tRNA methylation; decreased function in mitochondrial tRNA processing; dbSNP:rs886041974
- R226 (= R216) to Q: in HSD10MD; strongly decreased 3-hydroxyacyl-CoA dehydrogenase activity; abolished mitochondrial tRNA 5'-end processing; abolished tRNA methylation; impaired homotetramerization; dbSNP:rs1556894502
- N247 (= N237) to S: in HSD10MD; strongly decreased 3-hydroxyacyl-CoA dehydrogenase activity; abolished mitochondrial tRNA 5'-end processing; abolished tRNA methylation; impaired homotetramerization; dbSNP:rs122461163
- E249 (= E239) to Q: in HSD10MD; decreased 3-hydroxy-2-methylbutyryl-CoA dehydrogenase activity; dbSNP:rs62626305
O08756 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-estradiol 17-dehydrogenase; 2-methyl-3-hydroxybutyryl-CoA dehydrogenase; MHBD; 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; 3alpha(or 20beta)-hydroxysteroid dehydrogenase; 7-alpha-hydroxysteroid dehydrogenase; Endoplasmic reticulum-associated amyloid beta-peptide-binding protein; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Short chain dehydrogenase/reductase family 5C member 1; Short-chain type dehydrogenase/reductase XH98G2; Type II HADH; EC 1.1.1.35; EC 1.1.1.62; EC 1.1.1.239; EC 1.1.1.178; EC 1.1.1.53; EC 1.1.1.159 from Mus musculus (Mouse)
56% identity, 99% coverage: 3:251/252 of query aligns to 8:261/261 of O08756
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
1e6wC Rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh and estradiol (see paper)
55% identity, 99% coverage: 2:251/252 of query aligns to 1:248/248 of 1e6wC
- active site: G15 (= G16), N115 (= N111), T147 (= T143), S149 (= S145), Y162 (= Y158), K166 (= K162), F195 (= F191)
- binding estradiol: Q159 (= Q155), Y162 (= Y158), L200 (= L196)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), S14 (= S15), G15 (= G16), L16 (= L17), D35 (= D36), V36 (≠ M37), N58 (≠ D57), V59 (= V58), C85 (= C83), A86 (= A84), T147 (= T143), Y162 (= Y158), K166 (= K162), P192 (= P188), L194 (≠ I190), F195 (= F191), T197 (= T193), L199 (≠ M195)
2o23B The structure of wild-type human hadh2 (17beta-hydroxysteroid dehydrogenase type 10) bound to NAD+ at 1.2 a
56% identity, 99% coverage: 3:251/252 of query aligns to 8:253/255 of 2o23B
- active site: G21 (= G16), N121 (= N111), T153 (= T143), S155 (= S145), Y168 (= Y158), K172 (= K162), F201 (= F191)
- binding nicotinamide-adenine-dinucleotide: G17 (= G12), S20 (= S15), G21 (= G16), L22 (= L17), D41 (= D36), L42 (≠ M37), D64 (= D57), V65 (= V58), C91 (= C83), A92 (= A84), T153 (= T143), Y168 (= Y158), K172 (= K162), P198 (= P188), L200 (≠ I190), F201 (= F191), T203 (= T193), L205 (≠ M195)
1uayA Crystal structure of type ii 3-hydroxyacyl-coa dehydrogenase from thermus thermophilus hb8
54% identity, 97% coverage: 9:252/252 of query aligns to 5:241/241 of 1uayA
- active site: G12 (= G16), S134 (= S145), Y147 (= Y158), K151 (= K162)
- binding adenosine: G8 (= G12), S11 (= S15), D32 (= D36), L33 (≠ M37), D46 (= D57), V47 (= V58), A73 (= A84), G74 (= G85)
6ujkA Crystal structure of a probable short-chain type dehydrogenase/reductase (rv1144) from mycobacterium tuberculosis with bound NAD
53% identity, 100% coverage: 1:252/252 of query aligns to 2:246/246 of 6ujkA
- binding nicotinamide-adenine-dinucleotide: G13 (= G12), S16 (= S15), G17 (= G16), L18 (= L17), D37 (= D36), L38 (≠ M37), D57 (= D57), V58 (= V58), C83 (= C83), A84 (= A84), T142 (= T143), S144 (= S145), Y157 (= Y158), K161 (= K162), G188 (= G189), F190 (= F191), T192 (= T193), L194 (≠ M195)
7n09A Structural basis for branched substrate selectivity in a ketoreductase from ascaris suum
50% identity, 98% coverage: 4:249/252 of query aligns to 7:257/259 of 7n09A
- binding nicotinamide-adenine-dinucleotide: G15 (= G12), S18 (= S15), G19 (= G16), L20 (= L17), D39 (= D36), L40 (≠ M37), S62 (≠ D57), V63 (= V58), C89 (= C83), A90 (= A84), S153 (= S145), Y166 (= Y158), K170 (= K162), P196 (= P188), G197 (= G189), I198 (= I190), F199 (= F191), T201 (= T193), M203 (= M195)
3ppiA Crystal structure of 3-hydroxyacyl-coa dehydrogenase type-2 from mycobacterium avium (see paper)
46% identity, 99% coverage: 3:252/252 of query aligns to 5:258/258 of 3ppiA
4nbuB Crystal structure of fabg from bacillus sp (see paper)
36% identity, 98% coverage: 3:249/252 of query aligns to 5:244/244 of 4nbuB
- active site: G18 (= G16), N111 (= N111), S139 (= S145), Q149 (= Q155), Y152 (= Y158), K156 (= K162)
- binding acetoacetyl-coenzyme a: D93 (vs. gap), K98 (≠ E90), S139 (= S145), N146 (≠ Q152), V147 (≠ I153), Q149 (= Q155), Y152 (= Y158), F184 (≠ I190), M189 (= M195), K200 (≠ A206)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), N17 (≠ S15), G18 (= G16), I19 (≠ L17), D38 (= D36), F39 (≠ M37), V59 (≠ C56), D60 (= D57), V61 (= V58), N87 (≠ C83), A88 (= A84), G89 (= G85), I90 (= I86), T137 (= T143), S139 (= S145), Y152 (= Y158), K156 (= K162), P182 (= P188), F184 (≠ I190), T185 (≠ F191), T187 (= T193), M189 (= M195)
4cqlI Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD (see paper)
32% identity, 92% coverage: 3:234/252 of query aligns to 6:234/251 of 4cqlI
- active site: G19 (= G16), S146 (= S145), Y159 (= Y158), K163 (= K162)
- binding nicotinamide-adenine-dinucleotide: S18 (= S15), G19 (= G16), I20 (≠ L17), D39 (= D36), L40 (≠ M37), A64 (= A66), D65 (≠ V67), V66 (= V68), C93 (= C83), A94 (= A84), G95 (= G85), I96 (= I86), V116 (= V110), I144 (≠ T143), S146 (= S145), Y159 (= Y158), K163 (= K162), P189 (= P188), G190 (= G189), I192 (≠ F191), T194 (= T193), M196 (= M195)
Q92506 (3R)-3-hydroxyacyl-CoA dehydrogenase; 17-beta-hydroxysteroid dehydrogenase 8; 17-beta-HSD 8; HSD17B8; 3-ketoacyl-[acyl-carrier-protein] reductase alpha subunit; KAR alpha subunit; 3-oxoacyl-[acyl-carrier-protein] reductase; Estradiol 17-beta-dehydrogenase 8; Protein Ke6; Ke6; Short chain dehydrogenase/reductase family 30C member 1; Testosterone 17-beta-dehydrogenase 8; EC 1.1.1.n12; EC 1.1.1.62; EC 1.1.1.239 from Homo sapiens (Human) (see 2 papers)
32% identity, 92% coverage: 3:234/252 of query aligns to 9:244/261 of Q92506
- 15:23 (vs. 9:17, 56% identical) binding
- D42 (= D36) mutation to A: Reduced NADH-dependent reductase activity with acetoacetyl-CoA. Reduced NADH-dependent reductase activity with 9,10-phenanthrene quinone. Increases NADPH-dependent reductase activities. No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- DL 42:43 (≠ DM 36:37) binding
- ADV 74:76 (≠ AVV 66:68) binding
- R148 (= R137) mutation to E: No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- V158 (≠ A147) to L: in a breast cancer sample; somatic mutation
- Y169 (= Y158) mutation to A: Strongly reduced NADH-dependent reductase activity with acetoacetyl-CoA. Strongly reduced NADH-dependent reductase activity with 9,10-phenanthrene quinone. Decreases NADPH-dependent reductase activity with acetoacetyl-CoA, but increases NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- YAASK 169:173 (≠ YSASK 158:162) binding
- K173 (= K162) mutation to A: Abolishes NADH-dependent reductase activity with acetoacetyl-CoA. Strongly reduced NADH-dependent reductase activity with 9,10-phenanthrene quinone. Slightly decreases NADPH-dependent reductase activity with acetoacetyl-CoA, but increases NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- R189 (= R178) mutation to E: No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- IAT 202:204 (≠ FGT 191:193) binding
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
34% identity, 98% coverage: 3:249/252 of query aligns to 3:239/239 of 4nbtA
- active site: G16 (= G16), S132 (= S145), Y145 (= Y158), K149 (= K162)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), K15 (≠ S15), G16 (= G16), L17 (= L17), D36 (= D36), L37 (≠ M37), L52 (≠ V54), N53 (≠ K55), V54 (≠ C56), N80 (≠ C83), A81 (= A84), G82 (= G85), I130 (≠ T143), S132 (= S145), Y145 (= Y158), K149 (= K162), P177 (= P188), G178 (= G189), I180 (≠ F191), T182 (= T193)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
36% identity, 99% coverage: 1:249/252 of query aligns to 4:247/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G12), R18 (≠ S15), G19 (= G16), I20 (≠ L17), D39 (= D36), R40 (≠ M37), C63 (= C56), I65 (≠ V58), N91 (≠ C83), G93 (= G85), I94 (= I86), V114 (= V110), Y155 (= Y158), K159 (= K162), I188 (≠ F191), T190 (= T193), T193 (≠ L196)
Query Sequence
>Ac3H11_2606 FitnessBrowser__acidovorax_3H11:Ac3H11_2606
MDIKGKVFIVTGGASGLGEGTARMLAAQGGTVVIADMQAEKGEAVAKEIGGAFVKCDVSN
EADGQAVVAKAVSLGKLMGLVNCAGIAPAEKTVGKNGAHALALFSKTITVNLIGSFNMIR
LAAEAMSKNEPEATGERGALISTASVAAYDGQIGQAAYSASKGGVVGMTLPIARDLARNG
IRNMTIAPGIFGTPMLFGMPQEVQDALAAGVPFPSRLGTPQDYAKLVKHIFENDMLNGEV
IRLDGAIRLAPR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory