SitesBLAST
Comparing Ac3H11_2607 FitnessBrowser__acidovorax_3H11:Ac3H11_2607 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
67% identity, 78% coverage: 12:380/473 of query aligns to 3:353/380 of 4g6zA
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
45% identity, 97% coverage: 11:470/473 of query aligns to 2:457/471 of P04805
- C98 (= C107) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (≠ M109) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (≠ W134) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ P136) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (≠ D138) mutation to Q: No change in activity or in zinc content.
- H131 (≠ K140) mutation to Q: No change in activity or in zinc content.
- H132 (≠ T141) mutation to Q: No change in activity or in zinc content.
- C138 (≠ A147) mutation to S: No change in activity or in zinc content.
- S239 (= S252) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
45% identity, 97% coverage: 11:470/473 of query aligns to 2:457/468 of 8i9iA
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
38% identity, 95% coverage: 12:461/473 of query aligns to 2:463/484 of 2cfoA
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
38% identity, 95% coverage: 12:461/473 of query aligns to 3:464/485 of Q8DLI5
- R6 (= R15) binding
- Y192 (= Y194) binding
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
34% identity, 97% coverage: 12:471/473 of query aligns to 2:476/485 of 4griB
- active site: S9 (= S19), K253 (= K253)
- binding glutamic acid: R5 (= R15), A7 (= A17), S9 (= S19), E41 (= E51), Y194 (= Y194), R212 (= R212), W216 (≠ H216)
- binding zinc ion: C105 (= C107), C107 (≠ M109), Y128 (= Y130), C132 (≠ W134)
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
34% identity, 97% coverage: 12:470/473 of query aligns to 2:463/468 of 1g59A
- binding : D44 (= D54), R45 (≠ L55), A46 (≠ E56), R47 (= R57), P109 (≠ V111), V145 (= V152), R163 (≠ K170), V166 (≠ I173), E172 (= E179), V177 (= V184), K180 (≠ R187), S181 (≠ P188), D182 (= D189), E207 (≠ D214), E208 (≠ D215), R237 (≠ L244), K241 (≠ G248), T242 (≠ E249), K243 (= K250), M273 (≠ L280), G274 (= G281), E282 (= E288), S299 (≠ G305), L300 (≠ R306), P303 (≠ A309), V304 (≠ Q310), K309 (= K315), W312 (= W318), R319 (≠ K325), P357 (≠ D364), R358 (= R365), R417 (≠ K424), K426 (= K433), L427 (≠ M434), Q432 (≠ M439), R435 (= R442), L442 (≠ A449), E443 (≠ H450), T444 (= T451), P445 (= P452), G446 (≠ S453), L447 (≠ V454), F448 (≠ D455)
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
34% identity, 97% coverage: 12:470/473 of query aligns to 2:463/468 of 2cv2A
- active site: K246 (= K253)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R15), A7 (= A17), S9 (= S19), G17 (= G27), I21 (≠ S31), E41 (= E51), Y187 (= Y194), R205 (= R212), A206 (≠ G213), E208 (≠ D215), W209 (≠ H216), L235 (≠ T242), L236 (≠ V243)
- binding : S9 (= S19), T43 (= T53), D44 (= D54), R47 (= R57), V145 (= V152), R163 (≠ K170), Y168 (≠ I175), E172 (= E179), V177 (= V184), K180 (≠ R187), S181 (≠ P188), Y187 (= Y194), E207 (≠ D214), E208 (≠ D215), W209 (≠ H216), V211 (≠ N218), R237 (≠ L244), K241 (≠ G248), L272 (≠ R279), M273 (≠ L280), G274 (= G281), E282 (= E288), S299 (≠ G305), P303 (≠ A309), V304 (≠ Q310), K309 (= K315), W312 (= W318), R319 (≠ K325), P357 (≠ D364), R358 (= R365), R417 (≠ K424), Q432 (≠ M439), R435 (= R442), L442 (≠ A449), E443 (≠ H450), T444 (= T451), G446 (≠ S453), L447 (≠ V454), F448 (≠ D455)
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
34% identity, 97% coverage: 12:470/473 of query aligns to 2:463/468 of 2cv1A
- active site: K246 (= K253)
- binding adenosine-5'-triphosphate: P8 (= P18), S9 (= S19), G17 (= G27), T18 (≠ N28), I21 (≠ S31), R47 (= R57), A206 (≠ G213), W209 (≠ H216), L235 (≠ T242), L236 (≠ V243)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R15), A7 (= A17), E41 (= E51), Y187 (= Y194), R205 (= R212), W209 (≠ H216)
- binding : S9 (= S19), E41 (= E51), T43 (= T53), D44 (= D54), R47 (= R57), V145 (= V152), R163 (≠ K170), V166 (≠ I173), E172 (= E179), V177 (= V184), K180 (≠ R187), S181 (≠ P188), Y187 (= Y194), E207 (≠ D214), E208 (≠ D215), W209 (≠ H216), V211 (≠ N218), R237 (≠ L244), K241 (≠ G248), K243 (= K250), M273 (≠ L280), G274 (= G281), S276 (= S283), E282 (= E288), S299 (≠ G305), P303 (≠ A309), V304 (≠ Q310), K309 (= K315), W312 (= W318), R319 (≠ K325), P357 (≠ D364), R358 (= R365), R417 (≠ K424), L427 (≠ M434), Q432 (≠ M439), R435 (= R442), L442 (≠ A449), E443 (≠ H450), T444 (= T451), G446 (≠ S453), L447 (≠ V454), F448 (≠ D455)
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l-glutamate (see paper)
34% identity, 97% coverage: 12:470/473 of query aligns to 2:463/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
34% identity, 97% coverage: 12:470/473 of query aligns to 2:463/468 of 1n78A
- active site: K246 (= K253)
- binding glutamol-amp: R5 (= R15), A7 (= A17), P8 (= P18), S9 (= S19), G17 (= G27), T18 (≠ N28), I21 (≠ S31), E41 (= E51), Y187 (= Y194), N191 (≠ V198), R205 (= R212), A206 (≠ G213), E208 (≠ D215), W209 (≠ H216), L235 (≠ T242), L236 (≠ V243)
- binding : S9 (= S19), T43 (= T53), D44 (= D54), R47 (= R57), V145 (= V152), R163 (≠ K170), V166 (≠ I173), Y168 (≠ I175), E172 (= E179), V177 (= V184), K180 (≠ R187), S181 (≠ P188), Y187 (= Y194), E207 (≠ D214), E208 (≠ D215), W209 (≠ H216), L210 (≠ V217), V211 (≠ N218), R237 (≠ L244), K241 (≠ G248), M273 (≠ L280), G274 (= G281), E282 (= E288), R297 (≠ H303), P303 (≠ A309), V304 (≠ Q310), K309 (= K315), W312 (= W318), R319 (≠ K325), P357 (≠ D364), R358 (= R365), R417 (≠ K424), L427 (≠ M434), Q432 (≠ M439), R435 (= R442), L442 (≠ A449), E443 (≠ H450), T444 (= T451), G446 (≠ S453), L447 (≠ V454), F448 (≠ D455)
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
34% identity, 97% coverage: 12:470/473 of query aligns to 2:463/468 of 1j09A
- active site: K246 (= K253)
- binding adenosine-5'-triphosphate: H15 (= H25), E208 (≠ D215), L235 (≠ T242), L236 (≠ V243), K243 (= K250), I244 (≠ M251), S245 (= S252), K246 (= K253), R247 (= R254)
- binding glutamic acid: R5 (= R15), A7 (= A17), S9 (= S19), E41 (= E51), Y187 (= Y194), N191 (≠ V198), R205 (= R212), W209 (≠ H216)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
34% identity, 97% coverage: 12:470/473 of query aligns to 2:463/468 of P27000
- R358 (= R365) mutation to Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
31% identity, 97% coverage: 11:470/473 of query aligns to 2:494/502 of 6brlA
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
33% identity, 97% coverage: 12:470/473 of query aligns to 103:555/564 of 3al0C
- active site: S110 (= S19), K335 (= K253)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R15), A108 (= A17), P109 (= P18), G118 (= G27), T122 (≠ S31), E142 (= E51), Y276 (= Y194), R294 (= R212), G295 (= G213), D297 (= D215), H298 (= H216), L324 (≠ T242), I325 (≠ V243), L333 (≠ M251)
- binding : T144 (= T53), D145 (= D54), R148 (= R57), Y208 (≠ V111), P213 (≠ A116), K252 (= K170), M255 (≠ I173), I266 (≠ V184), K269 (≠ R187), S270 (≠ P188), Y276 (= Y194), D297 (= D215), H298 (= H216), L299 (≠ V217), S300 (≠ N218), N301 (= N219), K304 (≠ R222), R330 (≠ G248), P332 (≠ K250), G363 (= G281), W364 (= W282), R365 (≠ S283), E370 (= E288), S387 (≠ G305), K389 (≠ S307), V391 (≠ A309), I392 (≠ Q310), K397 (= K315), W400 (= W318), R407 (≠ K325), E446 (≠ D364), K447 (≠ R365), Q453 (≠ A371), I457 (≠ W375), R509 (≠ K424), K520 (≠ Q436), Q524 (≠ P440), R527 (= R442), V535 (≠ H450), T536 (= T451), G538 (≠ S453), L539 (≠ V454)
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
35% identity, 97% coverage: 12:472/473 of query aligns to 4:464/488 of 8vc5A
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
34% identity, 60% coverage: 15:297/473 of query aligns to 19:282/308 of P27305
- E55 (= E51) binding
- Y182 (= Y194) binding
- R200 (= R212) binding
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
33% identity, 60% coverage: 15:297/473 of query aligns to 7:268/290 of 4a91A
- active site: S11 (= S19), K229 (= K253)
- binding glutamic acid: R7 (= R15), A9 (= A17), S11 (= S19), E43 (= E51), Y170 (= Y194), R188 (= R212), L192 (≠ H216)
- binding zinc ion: C99 (= C107), C101 (≠ M109), Y113 (= Y130), C117 (≠ W134)
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
31% identity, 49% coverage: 6:239/473 of query aligns to 5:228/455 of 3aiiA
Sites not aligning to the query:
O13775 Probable glutamate--tRNA ligase, cytoplasmic; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 45% coverage: 10:221/473 of query aligns to 205:413/716 of O13775
Sites not aligning to the query:
- 190 modified: Phosphoserine
Query Sequence
>Ac3H11_2607 FitnessBrowser__acidovorax_3H11:Ac3H11_2607
MTETTASSAGRVRTRFAPSPTGFIHLGNIRSALYPWAFARATGGDFILRIEDTDLERSSQ
AAVDVIIEGMAWLGLDHDEGPFYQMQRMDRYKAVLADLQAAGHVYPCYMSVAELDALREK
QMAAKEKPRYDGTWRPEDGKTLPPVPAGVLPVLRFKNPRGGVVAWDDKVKGRIEIRNDEL
DDLVIARPDGTPTYNFCVVVDDIDMDITHVIRGDDHVNNTPRQINIFRALGKEPPVYAHL
PTVLNEQGEKMSKRNGAKPVTQYRDEGYLPDAMVNYLARLGWSHGDDEIFSRAQFLEWFN
LDHLGRSAAQFDEAKLRWVNAQHLKAMADDALAALVAPQLQQRGVSEQALADGRLVRICA
LFKDRCDTTVALAQWAHVFYGDVTPVEAERAQHVTDAIAPALDALADALSVCEWDKASIG
AAFKQVLVNQGLKMPQLAMPARVLTVGTAHTPSVDAVLELVGREKVVARLRNR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory