SitesBLAST
Comparing Ac3H11_2632 FitnessBrowser__acidovorax_3H11:Ac3H11_2632 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6w04A Crystal structure of had hydrolase, family ia, variant 3 from entamoeba histolytica hm-1:imss
30% identity, 86% coverage: 3:195/224 of query aligns to 1:196/223 of 6w04A
- active site: D7 (= D9), F8 (≠ M10), N9 (≠ D11), D15 (≠ S17), N44 (≠ T46), T109 (= T110), S110 (≠ A111), K144 (= K143), E168 (= E167), D169 (= D168)
- binding magnesium ion: D7 (= D9), N9 (≠ D11), D169 (= D168)
3qypB Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47asn mutant complexed with calcium and phosphate (see paper)
26% identity, 83% coverage: 3:188/224 of query aligns to 9:196/228 of 3qypB
- active site: D15 (= D9), D17 (= D11), S23 (= S17), N51 (≠ T46), V116 (≠ G109), T117 (= T110), K151 (= K143), E175 (= E167), N176 (≠ D168)
- binding calcium ion: D15 (= D9), D17 (= D11), N51 (≠ T46), N176 (≠ D168)
- binding phosphate ion: D15 (= D9), M16 (= M10), D17 (= D11), N51 (≠ T46), T117 (= T110), G118 (vs. gap)
3qu2A Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, a closed cap conformation (see paper)
26% identity, 83% coverage: 3:188/224 of query aligns to 2:189/221 of 3qu2A
- active site: D8 (= D9), D10 (= D11), S16 (= S17), E44 (≠ T46), V109 (≠ G109), T110 (= T110), K144 (= K143), E168 (= E167), N169 (≠ D168)
- binding magnesium ion: D8 (= D9), D10 (= D11), E44 (≠ T46), N169 (≠ D168)
Q8VZ10 Protein SUPPRESSOR OF QUENCHING 1, chloroplastic; EC 3.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 89% coverage: 3:201/224 of query aligns to 74:277/1055 of Q8VZ10
- D80 (= D9) mutation to N: Complete rescue in complementation test of the nonphotochemical quenching (NPQ) phenotype observed in disrupted plants.
Sites not aligning to the query:
- 431:434 CINC→SINS: No rescue in complementation test of the nonphotochemical quenching (NPQ) phenotype observed in disrupted plants.
- 859 E→K: In soq1-2; high light intensity-dependent and irreversible nonphotochemical quenching (NPQ) due to a decrease in chlorophyll excited-state lifetime.
4g9bA Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
31% identity, 88% coverage: 1:198/224 of query aligns to 2:203/227 of 4g9bA
- active site: D10 (= D9), L11 (≠ M10), D12 (= D11), T18 (≠ S17), K46 (≠ T46), S117 (≠ G112), V118 (≠ D113), K148 (= K143), E172 (= E167), D173 (= D168)
- binding magnesium ion: D10 (= D9), D12 (= D11), D173 (= D168)
1te2A Putative phosphatase ynic from escherichia coli k12
27% identity, 96% coverage: 2:216/224 of query aligns to 2:217/218 of 1te2A
- active site: D9 (= D9), D11 (= D11), S17 (= S17), D44 (= D40), S111 (≠ T110), A112 (= A111), K144 (= K143), E168 (= E167), D169 (= D168)
- binding calcium ion: D9 (= D9), D11 (= D11), D169 (= D168)
- binding 2-phosphoglycolic acid: D9 (= D9), M10 (= M10), D11 (= D11), G47 (vs. gap), S111 (≠ T110), A112 (= A111), K144 (= K143)
P77247 Hexitol phosphatase B; 2-deoxyglucose-6-phosphate phosphatase; Mannitol-1-phosphatase; Sorbitol-6-phosphatase; Sugar-phosphatase; EC 3.1.3.68; EC 3.1.3.22; EC 3.1.3.50; EC 3.1.3.23 from Escherichia coli (strain K12) (see paper)
27% identity, 96% coverage: 2:216/224 of query aligns to 6:221/222 of P77247
- D13 (= D9) binding ; mutation to A: Loss of phosphatase activity.
- D15 (= D11) binding
- D173 (= D168) binding
3s6jE The crystal structure of a hydrolase from pseudomonas syringae
28% identity, 82% coverage: 5:188/224 of query aligns to 4:188/220 of 3s6jE
- active site: D8 (= D9), D10 (= D11), S16 (= S17), I44 (≠ N49), T110 (= T110), S111 (≠ A111), K143 (= K143), G167 (≠ E167), D168 (= D168)
- binding calcium ion: D8 (= D9), D10 (= D11), D168 (= D168)
P71447 Beta-phosphoglucomutase; Beta-PGM; EC 5.4.2.6 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see 3 papers)
26% identity, 96% coverage: 4:219/224 of query aligns to 3:215/221 of P71447
- D8 (= D9) modified: 4-aspartylphosphate; mutation to A: Inactive.; mutation to E: Inactive.
- D10 (= D11) mutation to A: Inactive.; mutation to E: Inactive.; mutation to N: Inactive.; mutation to S: Inactive.
- T16 (≠ S17) mutation to P: 500-fold reduction in the rate constant for Asp-8 phosphorylation by beta-G1,6bisP. 6,700-fold reduction in the apparent rate constant for cycling of the phosphorylated enzyme to convert beta-G1P to G6P. 13-fold increase in the estimated rate constant for phosphoryl transfer from the phospho-Asp8 to water.
- H20 (= H21) mutation to A: Impairs Asp-8 phosphorylation by beta-G1,6bisP and phosphoryl transfer from the phospho-Asp8 to the substrate beta-G1P.; mutation to N: 300-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.; mutation to Q: 8-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.
- K45 (≠ A43) mutation to A: 20'000-fold decrease in kcat/KM.
- G46 (≠ R44) mutation to A: 1'000'000-fold decrease in kcat/KM.; mutation to P: 100'000-fold decrease in kcat/KM.; mutation to V: 10'000-fold decrease in kcat/KM.
- R49 (≠ G47) mutation to K: 1'000'000-fold decrease in kcat/KM.
- S52 (≠ G50) mutation to A: Wild-type activity.
- K76 (= K74) mutation to A: 100-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.
- D170 (= D168) mutation to A: Impaired, but active with an increase in the affinity for G1P.
5olwA 5-fluorotryptophan labeled beta-phosphoglucomutase in an open conformation (see paper)
26% identity, 82% coverage: 4:186/224 of query aligns to 3:188/224 of 5olwA
- active site: D8 (= D9), L9 (≠ M10), D10 (= D11), T16 (≠ S17), K45 (≠ A43), S114 (≠ T110), A115 (= A111), K145 (= K143), E169 (= E167), D170 (= D168)
- binding calcium ion: D8 (= D9), D10 (= D11), P89 (= P84), V92 (≠ T87), E124 (≠ G122), N127 (≠ G125), E169 (= E167), D170 (= D168), S171 (≠ A169)
6qzgA Beta-glucose 1,6-bisphosphonate bound to wild type beta- phosphoglucomutse in an open conformation.
26% identity, 88% coverage: 4:201/224 of query aligns to 3:200/219 of 6qzgA
- binding 3,7-anhydro-1,2,8-trideoxy-1,8-diphosphono-D-glycero-D-gulo-octitol: D8 (= D9), L9 (≠ M10), D10 (= D11), H20 (= H21), G46 (≠ R44), S114 (≠ T110), A115 (= A111), S116 (≠ G112), K117 (≠ G115), K145 (= K143)
- binding magnesium ion: D8 (= D9), D10 (= D11), D170 (= D168)
6h91A Phosphorylated beta-phosphoglucomutase from lactococcus lactis in an open conformer to 2.4 a
26% identity, 88% coverage: 4:201/224 of query aligns to 3:200/218 of 6h91A
4c4rA Structure of beta-phosphoglucomutase in complex with a phosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride (see paper)
26% identity, 88% coverage: 4:201/224 of query aligns to 3:200/218 of 4c4rA
- active site: D8 (= D9), L9 (≠ M10), D10 (= D11), T16 (≠ S17), K45 (≠ A43), S114 (≠ T110), A115 (= A111), K145 (= K143), E169 (= E167), D170 (= D168)
- binding magnesium ion: D8 (= D9), D10 (= D11), D170 (= D168)
- binding trifluoromagnesate: D8 (= D9), L9 (≠ M10), D10 (= D11), S114 (≠ T110), A115 (= A111), K145 (= K143)
- binding (1R)-1,5-anhydro-1-(phosphonomethyl)-D-glucitol: D10 (= D11), H20 (= H21), W24 (= W25), L44 (≠ M42), G46 (≠ R44), V47 (≠ T45), R49 (≠ G47), S52 (≠ G50), S116 (≠ G112), K117 (≠ G115)
3zi4A The structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and scandium tetrafluoride
26% identity, 88% coverage: 4:201/224 of query aligns to 3:200/218 of 3zi4A
- active site: D8 (= D9), L9 (≠ M10), D10 (= D11), T16 (≠ S17), K45 (≠ A43), S114 (≠ T110), A115 (= A111), K145 (= K143), E169 (= E167), D170 (= D168)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D11), H20 (= H21), G46 (≠ R44), V47 (≠ T45), R49 (≠ G47), S116 (≠ G112), K117 (≠ G115)
- binding magnesium ion: D8 (= D9), D10 (= D11), D170 (= D168)
- binding Scandium Tetrafluoride: D8 (= D9), L9 (≠ M10), D10 (= D11), S114 (≠ T110), A115 (= A111), K145 (= K143)
2wf8A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, glucose-1-phosphate and beryllium trifluoride (see paper)
26% identity, 88% coverage: 4:201/224 of query aligns to 3:200/218 of 2wf8A
- active site: D8 (= D9), L9 (≠ M10), D10 (= D11), T16 (≠ S17), K45 (≠ A43), S114 (≠ T110), A115 (= A111), K145 (= K143), E169 (= E167), D170 (= D168)
- binding beryllium trifluoride ion: D8 (= D9), L9 (≠ M10), D10 (= D11), S114 (≠ T110), A115 (= A111), K145 (= K143)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D11), H20 (= H21), G46 (≠ R44), V47 (≠ T45), R49 (≠ G47), A115 (= A111), S116 (≠ G112), K117 (≠ G115)
- binding 1-O-phosphono-alpha-D-glucopyranose: D10 (= D11), H20 (= H21), W24 (= W25), L44 (≠ M42), G46 (≠ R44), V47 (≠ T45), R49 (≠ G47), S52 (≠ G50), A115 (= A111), S116 (≠ G112), K117 (≠ G115)
- binding magnesium ion: D8 (= D9), D10 (= D11), D170 (= D168)
2wf7A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphonate and aluminium tetrafluoride (see paper)
26% identity, 88% coverage: 4:201/224 of query aligns to 3:200/218 of 2wf7A
- active site: D8 (= D9), L9 (≠ M10), D10 (= D11), T16 (≠ S17), K45 (≠ A43), S114 (≠ T110), A115 (= A111), K145 (= K143), E169 (= E167), D170 (= D168)
- binding tetrafluoroaluminate ion: D8 (= D9), L9 (≠ M10), D10 (= D11), S114 (≠ T110), K145 (= K143)
- binding 6,7-dideoxy-7-phosphono-beta-D-gluco-heptopyranose: D10 (= D11), G46 (≠ R44), V47 (≠ T45), R49 (≠ G47), S116 (≠ G112), K117 (≠ G115), N118 (= N116)
- binding magnesium ion: D8 (= D9), D10 (= D11), D170 (= D168)
2wf6A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and aluminium tetrafluoride (see paper)
26% identity, 88% coverage: 4:201/224 of query aligns to 3:200/218 of 2wf6A
- active site: D8 (= D9), L9 (≠ M10), D10 (= D11), T16 (≠ S17), K45 (≠ A43), S114 (≠ T110), A115 (= A111), K145 (= K143), E169 (= E167), D170 (= D168)
- binding tetrafluoroaluminate ion: D8 (= D9), L9 (≠ M10), D10 (= D11), S114 (≠ T110), K145 (= K143)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D11), G46 (≠ R44), V47 (≠ T45), R49 (≠ G47), S116 (≠ G112), K117 (≠ G115)
- binding magnesium ion: D8 (= D9), D10 (= D11), D170 (= D168)
2wf5A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and trifluoromagnesate (see paper)
26% identity, 88% coverage: 4:201/224 of query aligns to 3:200/218 of 2wf5A
- active site: D8 (= D9), L9 (≠ M10), D10 (= D11), T16 (≠ S17), K45 (≠ A43), S114 (≠ T110), A115 (= A111), K145 (= K143), E169 (= E167), D170 (= D168)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D11), H20 (= H21), G46 (≠ R44), V47 (≠ T45), R49 (≠ G47), A115 (= A111), S116 (≠ G112)
- binding magnesium ion: D8 (= D9), D10 (= D11), D170 (= D168)
- binding trifluoromagnesate: D8 (= D9), L9 (≠ M10), D10 (= D11), S114 (≠ T110), A115 (= A111), K145 (= K143)
1z4nA Structure of beta-phosphoglucomutase with inhibitor bound alpha- galactose 1-phosphate cocrystallized with fluoride (see paper)
26% identity, 88% coverage: 4:201/224 of query aligns to 3:200/219 of 1z4nA
- active site: D8 (= D9), L9 (≠ M10), D10 (= D11), T16 (≠ S17), K45 (≠ A43), S114 (≠ T110), A115 (= A111), K145 (= K143), E169 (= E167), D170 (= D168)
- binding 1-O-phosphono-alpha-D-galactopyranose: H20 (= H21), W24 (= W25), V47 (≠ T45), R49 (≠ G47), S116 (≠ G112), K117 (≠ G115), N118 (= N116)
- binding magnesium ion: D8 (= D9), D10 (= D11), E169 (= E167), D170 (= D168)
2wf9A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, and beryllium trifluoride, crystal form 2 (see paper)
26% identity, 88% coverage: 4:201/224 of query aligns to 3:200/221 of 2wf9A
- active site: D8 (= D9), L9 (≠ M10), D10 (= D11), T16 (≠ S17), K45 (≠ A43), S114 (≠ T110), A115 (= A111), K145 (= K143), E169 (= E167), D170 (= D168)
- binding beryllium trifluoride ion: D8 (= D9), L9 (≠ M10), D10 (= D11), S114 (≠ T110), A115 (= A111), K145 (= K143)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D11), H20 (= H21), G46 (≠ R44), V47 (≠ T45), R49 (≠ G47), S116 (≠ G112), K117 (≠ G115), N118 (= N116)
- binding 6-O-phosphono-alpha-D-glucopyranose: D10 (= D11), H20 (= H21), G46 (≠ R44), V47 (≠ T45), R49 (≠ G47), A115 (= A111), S116 (≠ G112), K117 (≠ G115), N118 (= N116)
- binding magnesium ion: D8 (= D9), D10 (= D11), D170 (= D168)
Query Sequence
>Ac3H11_2632 FitnessBrowser__acidovorax_3H11:Ac3H11_2632
MHVEAIIFDMDGTMIDSMPWHAQAWVEFARRRGMDIDVPDLMARTTGKNGTECIVELLGR
AVSQDEADALTHEKETIYRELFAPRFTEVAGFRQFAAQVRARGLKVAVGTAGDIGNVEFA
LGHLGLEPAPQAIVRGDEGLPGKPQPAIFLEAARRIAADPAHCIVFEDAPFGIEAARRAG
MRAVAICSTHTPEQLAGPHVLAAVRDYTELMNTDFLESIHVATA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory