SitesBLAST
Comparing Ac3H11_2717 FitnessBrowser__acidovorax_3H11:Ac3H11_2717 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P96855 Acyl-CoA dehydrogenase FadE34; ACAD; 3-oxochol-4-en-24-oyl-CoA dehydrogenase; EC 1.3.99.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 99% coverage: 4:328/329 of query aligns to 399:709/711 of P96855
- E581 (= E196) mutation to Q: Displays less than 1% activity with cholyl-CoA as substrate. Still binds FAD.
Sites not aligning to the query:
- 236 R→A: Displays less than 2% activity with cholyl-CoA as substrate. Cannot bind FAD.
P71858 Acyl-CoA dehydrogenase FadE29; ACAD; 3-oxo-23,24-bisnorchol-4-en-22-oyl-CoA dehydrogenase beta subunit; 3-oxo-4-pregnene-20-carboxyl-CoA dehydrogenase beta subunit; EC 1.3.99.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 97% coverage: 4:323/329 of query aligns to 59:376/387 of P71858
- E241 (= E196) mutation to Q: Unable to dehydrogenate pregnene-carboxyl-CoA ester.
8hk0B Crystal structure of fic32-33 complex from streptomyces ficellus nrrl 8067 (see paper)
32% identity, 97% coverage: 4:323/329 of query aligns to 60:370/379 of 8hk0B
- binding flavin-adenine dinucleotide: V126 (≠ I70), Y128 (≠ M72), T129 (≠ S73), G134 (= G78), S135 (= S79), F159 (≠ W107), S160 (≠ T108), L161 (≠ T109), G354 (≠ S307), S358 (≠ R311), T361 (= T314), E363 (= E316)
6wy9A Tcur3481-tcur3483 steroid acad g363a variant (see paper)
30% identity, 99% coverage: 4:328/329 of query aligns to 56:377/380 of 6wy9A
- active site: Y122 (≠ M72), T123 (≠ S73), E237 (= E196), T372 (≠ R324)
- binding dihydroflavine-adenine dinucleotide: I120 (= I70), Y122 (≠ M72), T123 (≠ S73), G128 (= G78), T129 (≠ S79), F153 (≠ W107), S155 (≠ T109), F358 (≠ L310), V362 (≠ T314), E364 (= E316)
6wy8B Tcur3481-tcur3483 steroid acad (see paper)
30% identity, 99% coverage: 4:328/329 of query aligns to 60:381/384 of 6wy8B
- active site: Y126 (≠ M72), T127 (≠ S73), E241 (= E196), T376 (≠ R324)
- binding flavin-adenine dinucleotide: I124 (= I70), Y126 (≠ M72), T127 (≠ S73), G132 (= G78), T133 (≠ S79), F157 (≠ W107), S159 (≠ T109), V359 (vs. gap), F362 (≠ L310), G363 (≠ R311), V366 (≠ T314), E368 (= E316)
4x28A Crystal structure of the chse4-chse5 complex from mycobacterium tuberculosis (see paper)
31% identity, 97% coverage: 4:322/329 of query aligns to 56:375/386 of 4x28A
- active site: Y122 (≠ M72), S123 (= S73), E240 (= E196), G365 (= G312)
- binding dihydroflavine-adenine dinucleotide: I120 (= I70), Y122 (≠ M72), S123 (= S73), G128 (= G78), T129 (≠ S79), W153 (= W107), S155 (≠ T109), F363 (≠ L310), T367 (= T314), E369 (= E316), V370 (≠ I317)
Sites not aligning to the query:
I6YCA3 Acyl-CoA dehydrogenase FadE26; ACAD; 3-oxocholest-4-en-26-oyl-CoA dehydrogenase alpha subunit; EC 1.3.99.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 97% coverage: 4:322/329 of query aligns to 63:388/400 of I6YCA3
- IGYS 127:130 (≠ IGMS 70:73) binding
- T136 (≠ S79) binding
- S162 (≠ T109) binding
- E247 (= E196) mutation to A: Loss of dehydrogenase activity.
- TNE 380:382 (≠ TRE 314:316) binding
8i4rA Crystal structure of acyl-coa dehydrogenase complexed with acetyl-coa from thermobifida fusca
38% identity, 55% coverage: 4:185/329 of query aligns to 54:232/381 of 8i4rA
Sites not aligning to the query:
- binding acetyl coenzyme *a: 234, 237, 238, 240, 241, 244, 365, 366, 377
- binding flavin-adenine dinucleotide: 360, 367, 369
8i4pA Crystal structure of acyl-coa dehydrogenase from thermobifida fusca
38% identity, 55% coverage: 4:185/329 of query aligns to 54:232/381 of 8i4pA
Sites not aligning to the query:
7w0jE Acyl-coa dehydrogenase, tfu_1647
38% identity, 55% coverage: 4:185/329 of query aligns to 55:233/382 of 7w0jE
Sites not aligning to the query:
- binding [[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2R,3S,4S)-5-azanyl-2,3,4-tris(oxidanyl)pentyl] hydrogen phosphate: 270, 272, 273, 277, 280, 283, 339, 340, 343, 365, 366, 368, 370, 371
2pg0A Crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus
27% identity, 98% coverage: 6:328/329 of query aligns to 58:380/380 of 2pg0A
- active site: M124 (= M72), T125 (≠ S73), E243 (= E196), A364 (≠ G312), R376 (= R324)
- binding flavin-adenine dinucleotide: I122 (= I70), M124 (= M72), T125 (≠ S73), G130 (= G78), S131 (= S79), F155 (≠ W107), I156 (≠ T108), T157 (= T109), R269 (≠ I214), F272 (≠ V217), F279 (≠ L224), Q337 (≠ A287), L338 (≠ V288), G340 (= G290), G341 (= G291), V359 (≠ S307), I362 (≠ L310), Y363 (≠ R311), T366 (= T314), E368 (= E316), M369 (≠ I317)
6es9A Methylsuccinyl-coa dehydrogenase of paracoccus denitrificans with bound flavin adenine dinucleotide (see paper)
34% identity, 57% coverage: 1:189/329 of query aligns to 210:401/545 of 6es9A
Sites not aligning to the query:
- active site: 408, 541
- binding coenzyme a: 75, 467, 470
- binding flavin-adenine dinucleotide: 50, 434, 436, 437, 441, 444, 502, 503, 505, 506, 528, 531, 533, 534
1ivhA Structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity (see paper)
27% identity, 99% coverage: 1:326/329 of query aligns to 58:384/387 of 1ivhA
- active site: M130 (= M72), S131 (= S73), E249 (= E196), A370 (≠ G312), R382 (= R324)
- binding coenzyme a persulfide: S137 (= S79), S185 (≠ A132), R186 (= R133), V239 (≠ W186), Y240 (≠ E187), M243 (≠ T190), E249 (= E196), R250 (= R197), G369 (≠ R311), A370 (≠ G312), G371 (= G313), V375 (≠ I317)
- binding flavin-adenine dinucleotide: L128 (≠ I70), M130 (= M72), S131 (= S73), G136 (= G78), S137 (= S79), W161 (= W107), T163 (= T109), R275 (vs. gap), F278 (≠ V217), F285 (≠ L224), M288 (≠ H227), Q343 (≠ P286), C344 (≠ A287), G347 (= G290), T372 (= T314), E374 (= E316)
8sgrA Isovaleryl-CoA dehydrogenase, mitochondrial (see paper)
27% identity, 99% coverage: 1:326/329 of query aligns to 62:388/393 of 8sgrA
- binding flavin-adenine dinucleotide: S135 (= S73), G140 (= G78), S141 (= S79), W165 (= W107), T167 (= T109), R279 (vs. gap), F282 (≠ V217), I286 (≠ P221), F289 (≠ L224), Q347 (≠ P286), C348 (≠ A287), G351 (= G290), L369 (≠ S307), G375 (= G313), T376 (= T314), L382 (≠ G320)
P26440 Isovaleryl-CoA dehydrogenase, mitochondrial; IVD; Butyryl-CoA dehydrogenase; EC 1.3.8.4; EC 1.3.8.1 from Homo sapiens (Human) (see 5 papers)
27% identity, 99% coverage: 1:326/329 of query aligns to 95:421/426 of P26440
- 165:174 (vs. 70:79, 70% identical) binding
- S174 (= S79) binding
- WIT 198:200 (≠ WTT 107:109) binding
- SR 222:223 (≠ AR 132:133) binding
- G250 (= G160) to A: in IVA; uncertain significance
- Y277 (≠ E187) binding
- DLER 284:287 (≠ AFER 194:197) binding
- E286 (= E196) active site, Proton acceptor; mutation to D: Residual isovaleryl-CoA dehydrogenase activity.; mutation to G: Loss of isovaleryl-CoA dehydrogenase activity. Does not affect isovaleryl-CoA dehydrogenase activity; when associated with 407-E.; mutation to Q: Loss of isovaleryl-CoA dehydrogenase activity.
- A291 (vs. gap) to V: in IVA; uncertain significance; dbSNP:rs886042098
- R312 (vs. gap) binding
- Q323 (= Q225) binding
- I379 (≠ A285) to T: in IVA; uncertain significance
- QCFGG 380:384 (≠ PAVGG 286:290) binding
- R398 (≠ Q303) to Q: in IVA; uncertain significance; dbSNP:rs1477527791
- Y403 (≠ F308) to N: in IVA; uncertain significance
- A407 (≠ G312) mutation to E: Does not affect isovaleryl-CoA dehydrogenase activity; when associated with 286-D.
- AG 407:408 (≠ GG 312:313) binding
- TSE 409:411 (≠ TRE 314:316) binding
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
3pfdC Crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr (see paper)
35% identity, 59% coverage: 3:197/329 of query aligns to 47:234/369 of 3pfdC
Sites not aligning to the query:
- active site: 353, 365
- binding dihydroflavine-adenine dinucleotide: 259, 262, 266, 269, 326, 327, 330, 348, 352, 355, 357
5lnxD Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
32% identity, 60% coverage: 1:199/329 of query aligns to 50:242/374 of 5lnxD
Sites not aligning to the query:
- active site: 358, 370
- binding flavin-adenine dinucleotide: 265, 267, 268, 272, 275, 278, 331, 332, 335, 357, 360, 362
P50544 Very long-chain specific acyl-CoA dehydrogenase, mitochondrial; MVLCAD; VLCAD; EC 1.3.8.9 from Mus musculus (Mouse) (see paper)
32% identity, 43% coverage: 45:187/329 of query aligns to 190:332/656 of P50544
- C238 (≠ A93) modified: S-nitrosocysteine
P49748 Very long-chain specific acyl-CoA dehydrogenase, mitochondrial; VLCAD; EC 1.3.8.9 from Homo sapiens (Human) (see 8 papers)
30% identity, 57% coverage: 1:187/329 of query aligns to 144:331/655 of P49748
- 214:223 (vs. 70:79, 50% identical) binding
- WIS 249:251 (≠ WTT 107:109) binding
Sites not aligning to the query:
- 1:40 modified: transit peptide, Mitochondrion
- 458 F → L: in ACADVLD; loss of acyl-CoA dehydrogenase activity; Loss of FAD cofactor-binding; dbSNP:rs118204017; F→T: Decreased acyl-CoA dehydrogenase activity. Decreased affinity for acyl-CoA. No effect on FAD cofactor-binding.; F→V: Loss of acyl-CoA dehydrogenase activity. Loss of FAD cofactor-binding.; F→Y: Decreased acyl-CoA dehydrogenase activity. No effect on affinity for acyl-CoA. Decreased FAD cofactor-binding.
- 461:463 binding
- 462 active site, Proton acceptor; E→D: Decreased acyl-CoA dehydrogenase activity. No effect on affinity for acyl-CoA. No effect on FAD cofactor-binding.; E→Q: Loss of acyl-CoA dehydrogenase activity. No effect on FAD cofactor-binding.
- 464:466 binding
- 490 A → P: in ACADVLD; decreased association with mitochondrial inner membrane; may affect substrate specificity, possibly reducing the affinity for long-chain acyl-CoA substrates; dbSNP:rs759775666; mutation A->G,V,S,D,H: Changed substrate specificity with decreased affinity for tetradecanoyl-CoA and hexadecanoyl-CoA.
- 502 L → P: in ACADVLD; decreased association with mitochondrial inner membrane; decreased specific activity towards several substrates in vitro
- 534 E → K: in ACADVLD; uncertain significance; dbSNP:rs2230180
- 562 binding
- 583 S → W: in ACADVLD; Loss of homodimerization; loss of localization to mitochondrial inner membrane; dbSNP:rs1085307648
8ca1B Cryo-em structure of the acadvl dimer from mus musculus. (see paper)
32% identity, 43% coverage: 45:187/329 of query aligns to 123:265/589 of 8ca1B
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 300, 302, 303, 307, 312, 313, 369, 370, 395, 400, 401
Query Sequence
>Ac3H11_2717 FitnessBrowser__acidovorax_3H11:Ac3H11_2717
MTLPHQYGGHDASPWARYVVIEELLAAGAPVSAHWIADRQSGPLILRYGTEAQRQKYLPG
ICKGEVYFCIGMSEPNSGSDLASIRSRAVRDEAAGDGSWRLSGQKVWTTNAHHAQYMIAL
VRTGAATGEKAARHEGMSQFIIDLKAAGVTVRPIRDLAGGEHFNEVYLDDVRLDADALIG
TEGQGWEQVTAELAFERSGPERFLSSMALLHTLIDAVGAQPDALQAHAVGRLSARLVVLR
QMSLAVTAELAAGGNPAWAASCLKDLGAAFEQEIPELAQQVLDVAPAVGGGSDHAQVLAA
LMQMAPSFSLRGGTREILRGIIARGLGLR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory