SitesBLAST
Comparing Ac3H11_2750 FitnessBrowser__acidovorax_3H11:Ac3H11_2750 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2b24A Crystal structure of naphthalene 1,2-dioxygenase from rhodococcus sp. Bound to indole (see paper)
34% identity, 93% coverage: 31:462/466 of query aligns to 28:435/440 of 2b24A
- active site: H111 (= H114), D213 (= D216), H216 (= H219), H221 (= H224), D372 (= D400)
- binding fe (iii) ion: H216 (= H219), H221 (= H224), D372 (= D400)
- binding fe2/s2 (inorganic) cluster: C88 (= C91), H90 (= H93), R91 (= R94), C108 (= C111), Y110 (= Y113), H111 (= H114), W113 (= W116)
- binding indole: D213 (= D216), H295 (≠ V324), F307 (= F335)
2b1xA Crystal structure of naphthalene 1,2-dioxygenase from rhodococcus sp. (see paper)
34% identity, 93% coverage: 31:462/466 of query aligns to 28:435/441 of 2b1xA
- active site: H111 (= H114), D213 (= D216), H216 (= H219), H221 (= H224), D372 (= D400)
- binding fe (iii) ion: H216 (= H219), H221 (= H224), D372 (= D400)
- binding fe2/s2 (inorganic) cluster: C88 (= C91), H90 (= H93), R91 (= R94), C108 (= C111), Y110 (= Y113), H111 (= H114), W113 (= W116)
Q53122 Biphenyl 2,3-dioxygenase subunit alpha; Biphenyl dioxygenase system, oxygenase component subunit alpha; BDO, oxygenase component subunit alpha; Rieske dioxygenase; Terminal oxygenase component of biphenyl dioxygenase, large subunit; EC 1.14.12.18 from Rhodococcus jostii (strain RHA1) (see paper)
34% identity, 87% coverage: 15:418/466 of query aligns to 22:396/460 of Q53122
- C98 (= C91) binding
- H100 (= H93) binding
- C118 (= C111) binding
- H121 (= H114) binding
- 217:230 (vs. 212:232, 24% identical) binding
- H224 (= H219) binding
- H230 (≠ N232) binding
- D378 (= D400) binding
1uliC Biphenyl dioxygenase (bpha1a2) derived from rhodococcus sp. Strain rha1 (see paper)
32% identity, 87% coverage: 15:418/466 of query aligns to 6:368/425 of 1uliC
- active site: H105 (= H114), D205 (= D216), H208 (= H219), H214 (≠ R225), D350 (= D400)
- binding fe (ii) ion: H208 (= H219), H214 (≠ R225), D350 (= D400)
- binding fe2/s2 (inorganic) cluster: C82 (= C91), H84 (= H93), R85 (= R94), C102 (= C111), Y104 (= Y113), H105 (= H114), W107 (= W116)
1uljA Biphenyl dioxygenase (bpha1a2) in complex with the substrate (see paper)
32% identity, 87% coverage: 15:418/466 of query aligns to 6:370/425 of 1uljA
- active site: H105 (= H114), D205 (= D216), H208 (= H219), H214 (≠ R225), D352 (= D400)
- binding biphenyl: Q201 (= Q212), F202 (≠ S213), D205 (= D216), M206 (≠ G217), H208 (= H219), A209 (≠ T220), H214 (≠ R225), I252 (≠ D267), H287 (≠ N308), L297 (≠ V345), F342 (= F390)
- binding fe (ii) ion: Q201 (= Q212), H208 (= H219), H214 (≠ R225), D352 (= D400)
- binding fe2/s2 (inorganic) cluster: C82 (= C91), H84 (= H93), R85 (= R94), M87 (= M96), C102 (= C111), Y104 (= Y113), H105 (= H114), W107 (= W116)
5aeuA Crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 (see paper)
34% identity, 85% coverage: 29:424/466 of query aligns to 21:386/433 of 5aeuA
- active site: H106 (= H114), D204 (= D216), H207 (= H219), H213 (≠ R225), D362 (= D400)
- binding fe (ii) ion: H207 (= H219), H213 (≠ R225), D362 (= D400)
- binding fe2/s2 (inorganic) cluster: C83 (= C91), H85 (= H93), R86 (= R94), M88 (= M96), C103 (= C111), Y105 (= Y113), H106 (= H114), W108 (= W116)
2xshA Crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with 2,6 di chlorobiphenyl (see paper)
33% identity, 85% coverage: 29:424/466 of query aligns to 21:386/433 of 2xshA
- active site: H106 (= H114), D204 (= D216), H207 (= H219), H213 (≠ R225), D362 (= D400)
- binding 2,6-dichlorobiphenyl: F201 (≠ S213), M205 (≠ G217), H207 (= H219), Q296 (vs. gap), H297 (vs. gap), L307 (≠ I338), F358 (≠ V396)
- binding fe (ii) ion: Q200 (= Q212), H207 (= H219), H213 (≠ R225), D362 (= D400)
- binding fe2/s2 (inorganic) cluster: C83 (= C91), H85 (= H93), R86 (= R94), C103 (= C111), Y105 (= Y113), H106 (= H114), W108 (= W116)
2xrxA Crystal structure of biphenyl dioxygenase in complex with biphenyl from burkholderia xenovorans lb400 (see paper)
33% identity, 85% coverage: 29:424/466 of query aligns to 21:385/432 of 2xrxA
- active site: H106 (= H114), D203 (= D216), H206 (= H219), H212 (≠ R225), D361 (= D400)
- binding biphenyl: Q199 (= Q212), F200 (≠ S213), D203 (= D216), H206 (= H219), H296 (vs. gap), L306 (≠ I338), F309 (≠ A341), F357 (≠ V396)
- binding fe (ii) ion: Q199 (= Q212), H206 (= H219), H212 (≠ R225), D361 (= D400)
- binding fe2/s2 (inorganic) cluster: C83 (= C91), H85 (= H93), R86 (= R94), C103 (= C111), Y105 (= Y113), H106 (= H114), W108 (= W116)
2yflA Crystal structure of biphenyl dioxygenase variant rr41 with 2-chloro dibenzofuran (see paper)
33% identity, 85% coverage: 29:424/466 of query aligns to 21:386/433 of 2yflA
- active site: H106 (= H114), D204 (= D216), H207 (= H219), H213 (≠ R225), D362 (= D400)
- binding 2-chlorodibenzofuran: Q200 (= Q212), D204 (= D216), M205 (≠ G217), H207 (= H219), S257 (≠ N290), H297 (vs. gap), L307 (≠ I338), F352 (= F390)
- binding fe (ii) ion: Q200 (= Q212), H207 (= H219), H213 (≠ R225), D362 (= D400)
- binding fe2/s2 (inorganic) cluster: C83 (= C91), H85 (= H93), R86 (= R94), C103 (= C111), Y105 (= Y113), H106 (= H114), W108 (= W116)
2yfjA Crystal structure of biphenyl dioxygenase variant rr41 with dibenzofuran (see paper)
33% identity, 85% coverage: 29:424/466 of query aligns to 21:386/433 of 2yfjA
- active site: H106 (= H114), D204 (= D216), H207 (= H219), H213 (≠ R225), D362 (= D400)
- binding dibenzofuran: Q200 (= Q212), F201 (≠ S213), D204 (= D216), M205 (≠ G217), H207 (= H219), A208 (≠ T220), H297 (vs. gap), L307 (≠ I338), F358 (≠ V396)
- binding fe (ii) ion: Q200 (= Q212), H207 (= H219), H213 (≠ R225), D362 (= D400)
- binding fe2/s2 (inorganic) cluster: C83 (= C91), H85 (= H93), R86 (= R94), C103 (= C111), Y105 (= Y113), H106 (= H114), W108 (= W116)
3gzxA Crystal structure of the biphenyl dioxygenase in complex with biphenyl from comamonas testosteroni sp. Strain b-356 (see paper)
31% identity, 87% coverage: 18:421/466 of query aligns to 10:390/440 of 3gzxA
- active site: H106 (= H114), D213 (= D216), H216 (= H219), H222 (≠ R225), D369 (= D400)
- binding biphenyl: Q209 (= Q212), F210 (≠ S213), H216 (= H219), G302 (≠ P322), H304 (≠ V324), L314 (≠ V345)
- binding fe (ii) ion: Q209 (= Q212), H216 (= H219), H222 (≠ R225), D369 (= D400)
- binding fe2/s2 (inorganic) cluster: C83 (= C91), H85 (= H93), R86 (= R94), C103 (= C111), Y105 (= Y113), H106 (= H114), W108 (= W116)
3en1A Crystal structure of toluene 2,3-dioxygenase (see paper)
28% identity, 97% coverage: 13:462/466 of query aligns to 4:422/424 of 3en1A
- active site: H105 (= H114), D205 (= D216), H208 (= H219), H214 (≠ R225), D360 (= D400)
- binding fe (ii) ion: Q201 (= Q212), H208 (= H219), H214 (≠ R225), D360 (= D400)
- binding fe2/s2 (inorganic) cluster: C82 (= C91), H84 (= H93), R85 (= R94), C102 (= C111), Y104 (= Y113), H105 (= H114), W107 (= W116)
- binding toluene: Q201 (= Q212), F202 (≠ S213), D205 (= D216), H208 (= H219), H295 (≠ Q304)
1wqlA Cumene dioxygenase (cuma1a2) from pseudomonas fluorescens ip01 (see paper)
32% identity, 85% coverage: 29:424/466 of query aligns to 21:389/436 of 1wqlA
- active site: H106 (= H114), D208 (= D216), H211 (= H219), H217 (≠ R225), D365 (= D400)
- binding fe (ii) ion: H211 (= H219), H217 (≠ R225), D365 (= D400)
- binding fe2/s2 (inorganic) cluster: C83 (= C91), H85 (= H93), R86 (= R94), C103 (= C111), Y105 (= Y113), H106 (= H114), W108 (= W116)
- binding oxygen molecule: H211 (= H219), F355 (= F390)
2gbxA Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 bound to biphenyl (see paper)
29% identity, 96% coverage: 15:462/466 of query aligns to 2:416/449 of 2gbxA
- active site: H98 (= H114), D199 (= D216), H202 (= H219), H207 (= H224), D355 (= D400)
- binding biphenyl: D199 (= D216), V203 (≠ T220), L255 (≠ R270), H288 (≠ P322), N290 (≠ V324), L300 (≠ V345)
- binding fe (iii) ion: H202 (= H219), H207 (= H224), D355 (= D400)
- binding fe2/s2 (inorganic) cluster: C75 (= C91), H77 (= H93), R78 (= R94), C95 (= C111), Y97 (= Y113), H98 (= H114), W100 (= W116)
2gbwA Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 (see paper)
29% identity, 96% coverage: 15:462/466 of query aligns to 2:416/449 of 2gbwA
- active site: H98 (= H114), D199 (= D216), H202 (= H219), H207 (= H224), D355 (= D400)
- binding fe (iii) ion: H202 (= H219), H207 (= H224), D355 (= D400)
- binding fe2/s2 (inorganic) cluster: C75 (= C91), H77 (= H93), R78 (= R94), C95 (= C111), Y97 (= Y113), H98 (= H114), W100 (= W116)
- binding oxygen molecule: H202 (= H219), F345 (= F390), D355 (= D400)
5xbpA Oxygenase component of 3-nitrotoluene dioxygenase from diaphorobacter sp. Strain ds2 (see paper)
31% identity, 83% coverage: 33:421/466 of query aligns to 20:380/444 of 5xbpA
- active site: H101 (= H114), D202 (= D216), H205 (= H219), H210 (= H224), D359 (= D400)
- binding fe (iii) ion: H205 (= H219), H210 (= H224), D359 (= D400)
- binding fe2/s2 (inorganic) cluster: C78 (= C91), H80 (= H93), R81 (= R94), C98 (= C111), Y100 (= Y113), H101 (= H114)
4hm0A Naphthalene 1,2-dioxygenase bound to indole-3-acetate
30% identity, 83% coverage: 33:421/466 of query aligns to 23:383/447 of 4hm0A
- active site: H104 (= H114), D205 (= D216), H208 (= H219), H213 (= H224), D362 (= D400)
- binding fe (iii) ion: H208 (= H219), H213 (= H224), D362 (= D400)
- binding fe2/s2 (inorganic) cluster: C81 (= C91), H83 (= H93), R84 (= R94), C101 (= C111), Y103 (= Y113), H104 (= H114), W106 (= W116)
- binding 1h-indol-3-ylacetic acid: N201 (≠ Q212), D205 (= D216), H208 (= H219), V209 (≠ T220), H213 (= H224), H295 (≠ K306), N297 (= N308)
1uuvA Naphthalene 1,2-dioxygenase with nitric oxide and indole bound in the active site. (see paper)
30% identity, 83% coverage: 33:421/466 of query aligns to 23:383/447 of 1uuvA
- active site: H104 (= H114), D205 (= D216), H208 (= H219), H213 (= H224), D362 (= D400)
- binding fe (iii) ion: H208 (= H219), H213 (= H224), D362 (= D400)
- binding fe2/s2 (inorganic) cluster: C81 (= C91), H83 (= H93), R84 (= R94), C101 (= C111), Y103 (= Y113), H104 (= H114), W106 (= W116)
- binding indole: N297 (= N308), L307 (≠ V345)
- binding nitric oxide: H208 (= H219), H213 (= H224)
1o7pA Naphthalene 1,2-dioxygenase, product complex (see paper)
30% identity, 83% coverage: 33:421/466 of query aligns to 23:383/447 of 1o7pA
- active site: H104 (= H114), D205 (= D216), H208 (= H219), H213 (= H224), D362 (= D400)
- binding fe (iii) ion: H208 (= H219), H213 (= H224), D362 (= D400)
- binding fe2/s2 (inorganic) cluster: C81 (= C91), H83 (= H93), R84 (= R94), C101 (= C111), Y103 (= Y113), H104 (= H114), W106 (= W116)
- binding (1r, 2s)-cis 1,2 dihydroxy-1,2-dihydronaphthalene: N201 (≠ Q212), H208 (= H219), V209 (≠ T220), H213 (= H224), H295 (≠ K306)
1o7mA Naphthalene 1,2-dioxygenase, binary complex with dioxygen (see paper)
30% identity, 83% coverage: 33:421/466 of query aligns to 23:383/447 of 1o7mA
- active site: H104 (= H114), D205 (= D216), H208 (= H219), H213 (= H224), D362 (= D400)
- binding fe (iii) ion: H208 (= H219), H213 (= H224), D362 (= D400)
- binding fe2/s2 (inorganic) cluster: C81 (= C91), H83 (= H93), R84 (= R94), C101 (= C111), Y103 (= Y113), H104 (= H114), W106 (= W116)
- binding oxygen molecule: H208 (= H219), H213 (= H224)
Query Sequence
>Ac3H11_2750 FitnessBrowser__acidovorax_3H11:Ac3H11_2750
MLSPTPPTLSDGTKVVDLVNVNTREVQMRALSDPELYELEMERIFGKIWVFLGHESEIPN
SGDFVTRDMGSDSVLVTRDKSGEVHVLLNLCTHRGMRVSTLDAGNTQIHTCIYHGWAFRP
NGAFLGAPVEKETMHGKMMSKEELGLKKARVTLYGGLIFATWNIDGPSFEEFLGDAKWYY
DILFKRTDKGMEVLGPPQRFTVRANWKAAGEQSAADGYHTLTLHRWLGEVGNYSKKGEGE
GSGGDLSPEMYGVEVSSPHGHALRCIDLGRKIRRMTGLDPDVLSVDEKLNALPPAGMTKE
MVEQLKRNLTPEQLHVQTSMPPQVGGIFPNVLFGFVYIPQADGSVVGSMTMHAYVPKGPD
KLEFVNWIFAEKDAPQELRDKMLRQTIQLFGTSGMVEQDDSDTWPHMTLAAKGAQGKKMT
LKYQAVYETGAPKGWPGPGIVNEGFTKDDTQWHWWLYWRQLMGDAV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory