SitesBLAST
Comparing Ac3H11_2755 FitnessBrowser__acidovorax_3H11:Ac3H11_2755 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2b1xA Crystal structure of naphthalene 1,2-dioxygenase from rhodococcus sp. (see paper)
33% identity, 95% coverage: 26:466/466 of query aligns to 23:439/441 of 2b1xA
- active site: H111 (= H114), D213 (= D216), H216 (= H219), H221 (= H224), D372 (= D400)
- binding fe (iii) ion: H216 (= H219), H221 (= H224), D372 (= D400)
- binding fe2/s2 (inorganic) cluster: C88 (= C91), H90 (= H93), R91 (= R94), C108 (= C111), Y110 (= Y113), H111 (= H114), W113 (= W116)
2b24A Crystal structure of naphthalene 1,2-dioxygenase from rhodococcus sp. Bound to indole (see paper)
33% identity, 95% coverage: 26:466/466 of query aligns to 23:439/440 of 2b24A
- active site: H111 (= H114), D213 (= D216), H216 (= H219), H221 (= H224), D372 (= D400)
- binding fe (iii) ion: H216 (= H219), H221 (= H224), D372 (= D400)
- binding fe2/s2 (inorganic) cluster: C88 (= C91), H90 (= H93), R91 (= R94), C108 (= C111), Y110 (= Y113), H111 (= H114), W113 (= W116)
- binding indole: D213 (= D216), H295 (≠ V324), F307 (= F335)
3en1A Crystal structure of toluene 2,3-dioxygenase (see paper)
29% identity, 97% coverage: 13:463/466 of query aligns to 4:423/424 of 3en1A
- active site: H105 (= H114), D205 (= D216), H208 (= H219), H214 (≠ R225), D360 (= D400)
- binding fe (ii) ion: Q201 (= Q212), H208 (= H219), H214 (≠ R225), D360 (= D400)
- binding fe2/s2 (inorganic) cluster: C82 (= C91), H84 (= H93), R85 (= R94), C102 (= C111), Y104 (= Y113), H105 (= H114), W107 (= W116)
- binding toluene: Q201 (= Q212), F202 (≠ G213), D205 (= D216), H208 (= H219), H295 (≠ I316)
Q53122 Biphenyl 2,3-dioxygenase subunit alpha; Biphenyl dioxygenase system, oxygenase component subunit alpha; BDO, oxygenase component subunit alpha; Rieske dioxygenase; Terminal oxygenase component of biphenyl dioxygenase, large subunit; EC 1.14.12.18 from Rhodococcus jostii (strain RHA1) (see paper)
29% identity, 96% coverage: 15:463/466 of query aligns to 22:440/460 of Q53122
- C98 (= C91) binding
- H100 (= H93) binding
- C118 (= C111) binding
- H121 (= H114) binding
- 217:230 (vs. 212:225, 36% identical) binding
- H224 (= H219) binding
- H230 (≠ R225) binding
- D378 (= D400) binding
2gbxA Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 bound to biphenyl (see paper)
28% identity, 95% coverage: 18:462/466 of query aligns to 2:416/449 of 2gbxA
- active site: H98 (= H114), D199 (= D216), H202 (= H219), H207 (= H224), D355 (= D400)
- binding biphenyl: D199 (= D216), V203 (≠ T220), L255 (≠ H273), H288 (≠ N320), N290 (≠ V324), L300 (≠ E334)
- binding fe (iii) ion: H202 (= H219), H207 (= H224), D355 (= D400)
- binding fe2/s2 (inorganic) cluster: C75 (= C91), H77 (= H93), R78 (= R94), C95 (= C111), Y97 (= Y113), H98 (= H114), W100 (= W116)
2gbwA Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 (see paper)
28% identity, 95% coverage: 18:462/466 of query aligns to 2:416/449 of 2gbwA
- active site: H98 (= H114), D199 (= D216), H202 (= H219), H207 (= H224), D355 (= D400)
- binding fe (iii) ion: H202 (= H219), H207 (= H224), D355 (= D400)
- binding fe2/s2 (inorganic) cluster: C75 (= C91), H77 (= H93), R78 (= R94), C95 (= C111), Y97 (= Y113), H98 (= H114), W100 (= W116)
- binding oxygen molecule: H202 (= H219), F345 (≠ L390), D355 (= D400)
1uliC Biphenyl dioxygenase (bpha1a2) derived from rhodococcus sp. Strain rha1 (see paper)
29% identity, 96% coverage: 15:463/466 of query aligns to 6:412/425 of 1uliC
- active site: H105 (= H114), D205 (= D216), H208 (= H219), H214 (≠ R225), D350 (= D400)
- binding fe (ii) ion: H208 (= H219), H214 (≠ R225), D350 (= D400)
- binding fe2/s2 (inorganic) cluster: C82 (= C91), H84 (= H93), R85 (= R94), C102 (= C111), Y104 (= Y113), H105 (= H114), W107 (= W116)
1uljA Biphenyl dioxygenase (bpha1a2) in complex with the substrate (see paper)
29% identity, 96% coverage: 15:463/466 of query aligns to 6:414/425 of 1uljA
- active site: H105 (= H114), D205 (= D216), H208 (= H219), H214 (≠ R225), D352 (= D400)
- binding biphenyl: Q201 (= Q212), F202 (≠ G213), D205 (= D216), M206 (≠ G217), H208 (= H219), A209 (≠ T220), H214 (≠ R225), I252 (= I266), H287 (≠ V324), L297 (= L338), F342 (≠ L390)
- binding fe (ii) ion: Q201 (= Q212), H208 (= H219), H214 (≠ R225), D352 (= D400)
- binding fe2/s2 (inorganic) cluster: C82 (= C91), H84 (= H93), R85 (= R94), M87 (= M96), C102 (= C111), Y104 (= Y113), H105 (= H114), W107 (= W116)
5aeuA Crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 (see paper)
29% identity, 97% coverage: 15:466/466 of query aligns to 7:427/433 of 5aeuA
- active site: H106 (= H114), D204 (= D216), H207 (= H219), H213 (≠ T222), D362 (= D400)
- binding fe (ii) ion: H207 (= H219), H213 (≠ T222), D362 (= D400)
- binding fe2/s2 (inorganic) cluster: C83 (= C91), H85 (= H93), R86 (= R94), M88 (= M96), C103 (= C111), Y105 (= Y113), H106 (= H114), W108 (= W116)
2xrxA Crystal structure of biphenyl dioxygenase in complex with biphenyl from burkholderia xenovorans lb400 (see paper)
29% identity, 97% coverage: 15:466/466 of query aligns to 7:426/432 of 2xrxA
- active site: H106 (= H114), D203 (= D216), H206 (= H219), H212 (≠ T222), D361 (= D400)
- binding biphenyl: Q199 (= Q212), F200 (≠ G213), D203 (= D216), H206 (= H219), H296 (≠ Q313), L306 (= L338), F309 (≠ A341), F357 (≠ V396)
- binding fe (ii) ion: Q199 (= Q212), H206 (= H219), H212 (≠ T222), D361 (= D400)
- binding fe2/s2 (inorganic) cluster: C83 (= C91), H85 (= H93), R86 (= R94), C103 (= C111), Y105 (= Y113), H106 (= H114), W108 (= W116)
2xshA Crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with 2,6 di chlorobiphenyl (see paper)
29% identity, 97% coverage: 15:466/466 of query aligns to 7:427/433 of 2xshA
- active site: H106 (= H114), D204 (= D216), H207 (= H219), H213 (≠ T222), D362 (= D400)
- binding 2,6-dichlorobiphenyl: F201 (≠ G213), M205 (≠ G217), H207 (= H219), Q296 (≠ E312), H297 (≠ Q313), L307 (= L338), F358 (≠ V396)
- binding fe (ii) ion: Q200 (= Q212), H207 (= H219), H213 (≠ T222), D362 (= D400)
- binding fe2/s2 (inorganic) cluster: C83 (= C91), H85 (= H93), R86 (= R94), C103 (= C111), Y105 (= Y113), H106 (= H114), W108 (= W116)
2yflA Crystal structure of biphenyl dioxygenase variant rr41 with 2-chloro dibenzofuran (see paper)
29% identity, 97% coverage: 15:466/466 of query aligns to 7:427/433 of 2yflA
- active site: H106 (= H114), D204 (= D216), H207 (= H219), H213 (≠ T222), D362 (= D400)
- binding 2-chlorodibenzofuran: Q200 (= Q212), D204 (= D216), M205 (≠ G217), H207 (= H219), S257 (≠ T262), H297 (≠ Q313), L307 (= L338), F352 (≠ L390)
- binding fe (ii) ion: Q200 (= Q212), H207 (= H219), H213 (≠ T222), D362 (= D400)
- binding fe2/s2 (inorganic) cluster: C83 (= C91), H85 (= H93), R86 (= R94), C103 (= C111), Y105 (= Y113), H106 (= H114), W108 (= W116)
2yfjA Crystal structure of biphenyl dioxygenase variant rr41 with dibenzofuran (see paper)
29% identity, 97% coverage: 15:466/466 of query aligns to 7:427/433 of 2yfjA
- active site: H106 (= H114), D204 (= D216), H207 (= H219), H213 (≠ T222), D362 (= D400)
- binding dibenzofuran: Q200 (= Q212), F201 (≠ G213), D204 (= D216), M205 (≠ G217), H207 (= H219), A208 (vs. gap), H297 (≠ Q313), L307 (= L338), F358 (≠ V396)
- binding fe (ii) ion: Q200 (= Q212), H207 (= H219), H213 (≠ T222), D362 (= D400)
- binding fe2/s2 (inorganic) cluster: C83 (= C91), H85 (= H93), R86 (= R94), C103 (= C111), Y105 (= Y113), H106 (= H114), W108 (= W116)
3gzxA Crystal structure of the biphenyl dioxygenase in complex with biphenyl from comamonas testosteroni sp. Strain b-356 (see paper)
28% identity, 97% coverage: 15:466/466 of query aligns to 7:434/440 of 3gzxA
- active site: H106 (= H114), D213 (= D216), H216 (= H219), H222 (≠ R225), D369 (= D400)
- binding biphenyl: Q209 (= Q212), F210 (≠ G213), H216 (= H219), G302 (≠ S307), H304 (≠ V324), L314 (= L338)
- binding fe (ii) ion: Q209 (= Q212), H216 (= H219), H222 (≠ R225), D369 (= D400)
- binding fe2/s2 (inorganic) cluster: C83 (= C91), H85 (= H93), R86 (= R94), C103 (= C111), Y105 (= Y113), H106 (= H114), W108 (= W116)
1wqlA Cumene dioxygenase (cuma1a2) from pseudomonas fluorescens ip01 (see paper)
28% identity, 97% coverage: 15:466/466 of query aligns to 7:430/436 of 1wqlA
- active site: H106 (= H114), D208 (= D216), H211 (= H219), H217 (≠ R225), D365 (= D400)
- binding fe (ii) ion: H211 (= H219), H217 (≠ R225), D365 (= D400)
- binding fe2/s2 (inorganic) cluster: C83 (= C91), H85 (= H93), R86 (= R94), C103 (= C111), Y105 (= Y113), H106 (= H114), W108 (= W116)
- binding oxygen molecule: H211 (= H219), F355 (≠ L390)
5xbpA Oxygenase component of 3-nitrotoluene dioxygenase from diaphorobacter sp. Strain ds2 (see paper)
30% identity, 85% coverage: 27:421/466 of query aligns to 14:380/444 of 5xbpA
- active site: H101 (= H114), D202 (= D216), H205 (= H219), H210 (= H224), D359 (= D400)
- binding fe (iii) ion: H205 (= H219), H210 (= H224), D359 (= D400)
- binding fe2/s2 (inorganic) cluster: C78 (= C91), H80 (= H93), R81 (= R94), C98 (= C111), Y100 (= Y113), H101 (= H114)
2ckfE Crystal structure of the terminal component of the pah- hydroxylating dioxygenase from sphingomonas sp chy-1 (see paper)
27% identity, 97% coverage: 9:462/466 of query aligns to 1:401/433 of 2ckfE
- active site: H103 (= H114), D204 (= D216), H207 (= H219), H212 (= H224), D340 (= D400)
- binding fe (iii) ion: H207 (= H219), H212 (= H224), D340 (= D400)
- binding fe2/s2 (inorganic) cluster: C80 (= C91), H82 (= H93), R83 (= R94), C100 (= C111), Y102 (= Y113), H103 (= H114), W105 (= W116)
2bmrA The crystal structure of nitrobenzene dioxygenase in complex with 3- nitrotoluene (see paper)
30% identity, 84% coverage: 27:419/466 of query aligns to 13:377/437 of 2bmrA
- active site: H100 (= H114), D201 (= D216), H204 (= H219), H209 (= H224), D358 (= D400)
- binding 3-nitrotoluene: F198 (≠ G213), D201 (= D216), H204 (= H219), V205 (≠ T220), N256 (≠ R274), F291 (≠ Q313), N293 (≠ E315)
- binding fe (iii) ion: H204 (= H219), H209 (= H224), D358 (= D400)
- binding fe2/s2 (inorganic) cluster: C77 (= C91), H79 (= H93), R80 (= R94), C97 (= C111), Y99 (= Y113), H100 (= H114), W102 (= W116)
2bmqA The crystal structure of nitrobenzene dioxygenase in complex with nitrobenzene (see paper)
30% identity, 84% coverage: 27:419/466 of query aligns to 13:377/437 of 2bmqA
- active site: H100 (= H114), D201 (= D216), H204 (= H219), H209 (= H224), D358 (= D400)
- binding fe (iii) ion: H204 (= H219), H209 (= H224), D358 (= D400)
- binding fe2/s2 (inorganic) cluster: C77 (= C91), H79 (= H93), R80 (= R94), C97 (= C111), Y99 (= Y113), H100 (= H114), W102 (= W116)
- binding nitrobenzene: N197 (≠ Q212), F198 (≠ G213), H204 (= H219), N256 (≠ R274), F291 (≠ Q313), N293 (≠ E315)
2bmoA The crystal structure of nitrobenzene dioxygenase (see paper)
30% identity, 84% coverage: 27:419/466 of query aligns to 13:377/437 of 2bmoA
- active site: H100 (= H114), D201 (= D216), H204 (= H219), H209 (= H224), D358 (= D400)
- binding fe (iii) ion: H204 (= H219), H209 (= H224), D358 (= D400)
- binding fe2/s2 (inorganic) cluster: C77 (= C91), H79 (= H93), R80 (= R94), C97 (= C111), Y99 (= Y113), H100 (= H114), W102 (= W116)
Query Sequence
>Ac3H11_2755 FitnessBrowser__acidovorax_3H11:Ac3H11_2755
MLTRSNPVLSDGTRISDLINLDTREVKMRVLSDAELYQLEMEKIFAKTWVFLAHETEIPN
SGDFVQRDMGSDSVLVTRDREGQVHVVLNVCTHRGMKVSTLDVGNTQAHMCIYHGWAFKP
NGDFIGAPVDKECMHGKMMSKEQLSLTKARVAVYGGMIFATWNLDGPSFDEFLGDAKFYY
DTMWCRTTSGMEVLGPPQRFIIKANWKTAAEQGACDGYHTLTLHRWLGEIGPYAKKPNAE
GGGADLTPEMYGVEVWTDHGHTMRCIDLGRKVHRITGRDPAELSAQEKLTVLPPPGLTAE
MIPDVVSRLSPEQIEIMSSNPPQVGNFFPNGLFEFIYLPTADGKVTGAMALHTYVPMGPD
KFMFMNWILAEKDTPPEQKAAMLRISCQFLGTSGMVEQDDSDTWPHQTIVSKGAMSKNIT
LKYQAKYETGKPDGWPGPGHVGSGFTKDDTNWSFWQYWHELMTRES
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory