SitesBLAST
Comparing Ac3H11_2774 FitnessBrowser__acidovorax_3H11:Ac3H11_2774 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
36% identity, 91% coverage: 6:256/276 of query aligns to 3:247/248 of 6ixmC
- active site: G16 (= G19), S142 (= S150), Y155 (= Y163), K159 (= K167)
- binding nicotinamide-adenine-dinucleotide: G12 (= G15), S15 (≠ A18), G16 (= G19), I17 (≠ L20), D36 (= D39), I37 (= I40), A61 (≠ T64), D62 (= D65), T63 (≠ L66), N89 (= N92), A90 (= A93), M140 (≠ A148), S142 (= S150), Y155 (= Y163), K159 (= K167), P185 (≠ I193), A186 (≠ G194), Y187 (≠ F195), I188 (≠ V196), L192 (≠ H200)
6vspA Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
37% identity, 93% coverage: 5:262/276 of query aligns to 2:251/251 of 6vspA
- active site: G16 (= G19), S138 (= S150), Y151 (= Y163)
- binding nicotinamide-adenine-dinucleotide: G12 (= G15), N15 (≠ A18), G16 (= G19), M17 (≠ L20), D36 (= D39), W37 (≠ I40), W37 (≠ I40), A38 (≠ N41), I59 (≠ T64), D60 (= D65), V61 (≠ L66), N87 (= N92), A88 (= A93), G89 (≠ A94), V90 (≠ A95), V110 (= V121), T136 (≠ A148), S138 (= S150), Y151 (= Y163), K155 (= K167), P181 (≠ I193), S182 (≠ G194), L183 (≠ F195), V184 (= V196), T186 (≠ E199), N187 (≠ H200), M188 (≠ A201), T189 (≠ Q202)
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
37% identity, 91% coverage: 5:256/276 of query aligns to 4:245/252 of 6vspB
6xewA Structure of serratia marcescens 2,3-butanediol dehydrogenase (see paper)
37% identity, 91% coverage: 5:256/276 of query aligns to 2:243/251 of 6xewA
- active site: G16 (= G19), S138 (= S150), Y151 (= Y163)
- binding r,3-hydroxybutan-2-one: S138 (= S150), S140 (≠ F152), Y151 (= Y163)
- binding s,3-hydroxybutan-2-one: S138 (= S150), Y151 (= Y163), S182 (≠ G194)
- binding nicotinamide-adenine-dinucleotide: G12 (= G15), N15 (≠ A18), G16 (= G19), M17 (≠ L20), D36 (= D39), W37 (≠ I40), W37 (≠ I40), A38 (≠ N41), I59 (≠ T64), D60 (= D65), V61 (≠ L66), N87 (= N92), A88 (= A93), G89 (≠ A94), V110 (= V121), T136 (≠ A148), S138 (= S150), Y151 (= Y163), K155 (= K167), S182 (≠ G194), L183 (≠ F195), V184 (= V196), T186 (≠ E199), N187 (≠ H200), M188 (≠ A201), T189 (≠ Q202)
H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see paper)
37% identity, 91% coverage: 5:256/276 of query aligns to 2:243/251 of H9XP47
- N15 (≠ A18) binding
- M17 (≠ L20) binding
- D36 (= D39) binding
- D60 (= D65) binding
- V61 (≠ L66) binding
- N87 (= N92) binding
- S138 (= S150) binding ; binding
- V139 (≠ G151) mutation to Q: Retains 50% of activity with acetoin as substrate; when associated with A-247.
- S140 (≠ F152) binding
- Y151 (= Y163) binding ; binding ; binding
- K155 (= K167) binding
- V184 (= V196) binding
- T186 (≠ E199) binding
- RDK 197:199 (≠ KQI 210:212) mutation to SEAAGKPLGYGTET: Mimics longer alpha6 helix. Retains 3% of activity with acetoin as substrate.
Sites not aligning to the query:
- 247 Q→A: Retains 10% of activity with acetoin as substrate. Retains 50% of activity with acetoin as substrate; when associated with Q-139.
A0A3Q8GL18 (+)-cis,trans-nepetalactol synthase NEPS1; Nepetalactol-related short-chain dehydrogenase; Nepetalactol dehydrogenase; Nepetalactol-related short-chain reductase 1; Nepetalactol-related SDR1; NmNEPS1; EC 5.5.1.34; EC 1.1.1.419 from Nepeta racemosa (Catmint) (Raceme catnip) (see paper)
36% identity, 91% coverage: 3:254/276 of query aligns to 12:262/271 of A0A3Q8GL18
- N125 (= N122) mutation to A: Strongly reduced cis-trans-nepetalactone levels.
- T152 (≠ A148) mutation to N: Absence of cis-trans-nepetalactone.
- T153 (= T149) mutation to A: Almost normal cis-trans-nepetalactone levels.
- T154 (≠ S150) mutation to G: Loss of dehydrogenase activity and strongly enhanced cis-trans-nepetalactol levels associated with a huge increase in Km for cis-trans-nepetalactol.
- P155 (≠ G151) mutation to S: Strongly reduced cis-trans-nepetalactone levels.
- L156 (≠ F152) mutation to S: Reduced dehydrogenase activity and absence of cis-trans-nepetalactone.
- Y167 (= Y163) mutation to F: Absence of cis-trans-nepetalactone.
- K171 (= K167) mutation to M: Absence of cis-trans-nepetalactone.
- S198 (≠ G194) mutation to M: Absence of cis-trans-nepetalactone.
- V199 (≠ F195) mutation to A: Almost normal cis-trans-nepetalactone levels.
- T202 (≠ N198) mutation to A: Absence of cis-trans-nepetalactone.
G9FRD7 7alpha-hydroxysteroid dehydrogenase; 7alpha-HSDH; NADP-dependent 7alpha-hydroxysteroid dehydrogenase; EC 1.1.1.- from Clostridium sardiniense (Clostridium absonum) (see 2 papers)
36% identity, 93% coverage: 4:259/276 of query aligns to 2:254/262 of G9FRD7
- SSTRGI 13:18 (≠ GAGAGL 15:20) binding
- R38 (≠ I40) binding ; mutation to D: Loss of catalytic activity.
- NA 63:64 (≠ DL 65:66) binding
- N90 (= N92) binding
- T145 (≠ S150) binding
- Y158 (= Y163) binding ; binding
- K162 (= K167) binding
- IGTRA 191:195 (≠ VLNEH 196:200) binding
Sites not aligning to the query:
- 261:262 mutation Missing: 5-fold reduction in catalytic efficiency.
5epoA The three-dimensional structure of clostridium absonum 7alpha- hydroxysteroid dehydrogenase (see paper)
36% identity, 93% coverage: 4:259/276 of query aligns to 1:253/261 of 5epoA
- active site: G16 (= G19), T144 (≠ S150), I152 (≠ A158), Y157 (= Y163), K161 (= K167), R193 (≠ E199)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S12 (≠ G15), T14 (≠ G17), R15 (≠ A18), G16 (= G19), I17 (≠ L20), R37 (≠ I40), F61 (≠ T64), N62 (≠ D65), N89 (= N92), Y90 (≠ A93), G91 (≠ A94), Y157 (= Y163), K161 (= K167), P187 (≠ I193), G188 (= G194), I190 (≠ V196), T192 (≠ N198), R193 (≠ E199), A194 (≠ H200), A195 (= A201)
- binding taurochenodeoxycholic acid: T93 (vs. gap), T144 (≠ S150), G146 (≠ F152), R154 (≠ L160), Y157 (= Y163), G188 (= G194), N198 (≠ G204), M199 (≠ V205), F203 (≠ I209)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
36% identity, 92% coverage: 4:256/276 of query aligns to 6:252/258 of 4wecA
- active site: G21 (= G19), S143 (= S150), Q154 (≠ L160), Y157 (= Y163), K161 (= K167)
- binding nicotinamide-adenine-dinucleotide: G17 (= G15), A19 (≠ G17), S20 (≠ A18), G21 (= G19), I22 (≠ L20), D41 (= D39), I42 (= I40), V61 (≠ T64), D62 (= D65), V63 (≠ L66), N89 (= N92), T141 (≠ A148), Y157 (= Y163), K161 (= K167), P187 (≠ I193), P189 (≠ F195), V190 (= V196)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
35% identity, 90% coverage: 6:254/276 of query aligns to 3:245/248 of 4urfB
- active site: G16 (= G19), S142 (= S150), I152 (≠ L160), Y155 (= Y163), K159 (= K167)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ T219), R211 (≠ P220), R212 (≠ Q221)
- binding bicarbonate ion: I92 (vs. gap), G94 (≠ A94), R109 (= R117), R179 (= R187), S228 (= S237)
- binding nicotinamide-adenine-dinucleotide: G12 (= G15), G14 (= G17), N15 (≠ A18), G16 (= G19), I17 (≠ L20), D36 (= D39), I37 (= I40), D62 (= D65), T63 (≠ L66), N89 (= N92), A90 (= A93), G91 (vs. gap), I140 (≠ A148), Y155 (= Y163), K159 (= K167), P185 (≠ I193), A186 (≠ G194), I188 (≠ V196), T190 (≠ E199)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
35% identity, 90% coverage: 6:254/276 of query aligns to 3:245/248 of 4urfA
- active site: G16 (= G19), S142 (= S150), I152 (≠ L160), Y155 (= Y163), K159 (= K167)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (vs. gap), S93 (vs. gap), G94 (≠ A94), E95 (≠ A95), T97 (≠ D97), E101 (≠ R101), T103 (≠ G103), Q106 (≠ A114), R109 (= R117), S175 (≠ K183), G177 (= G185)
- binding magnesium ion: S237 (≠ A246), Y238 (≠ V247)
- binding nicotinamide-adenine-dinucleotide: G12 (= G15), G14 (= G17), N15 (≠ A18), G16 (= G19), I17 (≠ L20), D36 (= D39), I37 (= I40), W41 (≠ G44), D62 (= D65), T63 (≠ L66), N89 (= N92), A90 (= A93), G91 (vs. gap), I140 (≠ A148), Y155 (= Y163), K159 (= K167), P185 (≠ I193), I188 (≠ V196), T190 (≠ E199)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
35% identity, 90% coverage: 6:254/276 of query aligns to 3:245/248 of 4ureB
- active site: G16 (= G19), S142 (= S150), I152 (≠ L160), Y155 (= Y163), K159 (= K167)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ A18), G16 (= G19), I17 (≠ L20), N89 (= N92), G91 (vs. gap), Y155 (= Y163), P185 (≠ I193), A186 (≠ G194)
6f9qC Binary complex of a 7s-cis-cis-nepetalactol cyclase from nepeta mussinii with NAD+ (see paper)
36% identity, 92% coverage: 1:253/276 of query aligns to 1:253/260 of 6f9qC
- active site: G19 (= G19), Y159 (= Y163)
- binding nicotinamide-adenine-dinucleotide: G15 (= G15), S18 (≠ A18), G19 (= G19), I20 (≠ L20), D40 (= D39), I41 (= I40), Q42 (≠ N41), C63 (≠ T64), D64 (= D65), V65 (≠ L66), N91 (= N92), A92 (= A93), G93 (≠ A94), N144 (≠ A148), Y159 (= Y163), K163 (= K167), P189 (vs. gap), M190 (vs. gap), V192 (≠ I193), T194 (≠ F195), P195 (≠ V196), L196 (= L197), T197 (≠ N198)
A0A3Q8GLE8 (+)-cis,cis-nepetalactol synthase NEPS3; Nepetalactol-related short-chain reductase 3; NmNEPS3; EC 5.5.1.35 from Nepeta racemosa (Catmint) (Raceme catnip) (see paper)
36% identity, 92% coverage: 1:253/276 of query aligns to 7:259/270 of A0A3Q8GLE8
- 21:27 (vs. 15:21, 43% identical) binding
- DIQ 46:48 (≠ DIN 39:41) binding
- DV 70:71 (≠ DL 65:66) binding
- N97 (= N92) binding
- N150 (≠ A148) mutation to T: No effect on catalytic activity.
- S154 (≠ F152) mutation to L: Abolishes catalytic activity.
- YVMSK 165:169 (≠ YAASK 163:167) binding
- K169 (= K167) mutation to M: Abolishes catalytic activity.
- M196 (vs. gap) mutation to S: Abolishes catalytic activity.
- VATPL 198:202 (≠ IGFVL 193:197) binding
4fn4A Short-chain NAD(h)-dependent dehydrogenase/reductase from sulfolobus acidocaldarius (see paper)
35% identity, 92% coverage: 2:255/276 of query aligns to 1:252/254 of 4fn4A
- active site: G18 (= G19), S144 (= S150), Y157 (= Y163), K161 (= K167), S202 (≠ Q207)
- binding nicotinamide-adenine-dinucleotide: G14 (= G15), S17 (≠ A18), G18 (= G19), I19 (≠ L20), E38 (≠ D39), L39 (≠ I40), R43 (≠ G44), A63 (≠ T64), D64 (= D65), V65 (≠ L66), N91 (= N92), G93 (≠ A94), I94 (≠ A95), T142 (≠ A148), S144 (= S150), Y157 (= Y163), K161 (= K167), P187 (≠ I193), V190 (= V196), T192 (≠ L197), N193 (= N198), I194 (≠ E199)
7x5jC Acp-dependent oxoacyl reductase
35% identity, 90% coverage: 6:254/276 of query aligns to 2:251/256 of 7x5jC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G15), S13 (≠ G17), G15 (= G19), L16 (= L20), N36 (≠ D39), R37 (≠ I40), N38 (= N41), D62 (= D65), V63 (≠ L66), N89 (= N92), A90 (= A93), A91 (= A94), V114 (= V121), I141 (≠ A148), Y156 (= Y163), K160 (= K167), L186 (≠ I193), G187 (= G194), V188 (≠ F195), R194 (≠ L197), S197 (≠ H200), S198 (≠ A201)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
35% identity, 90% coverage: 6:253/276 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G15), M16 (≠ L20), D35 (= D39), I36 (= I40), I62 (≠ L66), N88 (= N92), G90 (≠ A94), I138 (≠ A148), S140 (= S150), Y152 (= Y163), K156 (= K167), I185 (≠ V196)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
35% identity, 90% coverage: 6:253/276 of query aligns to 3:242/248 of Q9KJF1
- S15 (≠ A18) binding
- D36 (= D39) binding
- D62 (= D65) binding
- I63 (≠ L66) binding
- N89 (= N92) binding
- Y153 (= Y163) binding
- K157 (= K167) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
33% identity, 91% coverage: 5:254/276 of query aligns to 2:248/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G15), Q15 (≠ A18), G16 (= G19), I17 (≠ L20), D36 (= D39), V63 (≠ L66), N89 (= N92), A91 (= A94), S94 (≠ D97), I142 (≠ A148), S143 (≠ T149), S144 (= S150), Y157 (= Y163), K161 (= K167), P187 (≠ I193), H188 (≠ G194), I190 (≠ V196), I194 (≠ H200)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
35% identity, 89% coverage: 9:254/276 of query aligns to 5:244/246 of 3osuA
Query Sequence
>Ac3H11_2774 FitnessBrowser__acidovorax_3H11:Ac3H11_2774
MSERKLDGKVAIVTGAGAGLGAECARSLARHGARVAVVDINLEGAQSVAAEIKAGGGKAL
AIQTDLTSEEGVAAMVSAVLDHFGRIDVLHNNAAALDPAQRAGDRDVCNVDLSAWDRAMN
VNARGAMLCCKHAIPHMLKVGGGSIIFATSGFGLLGDATLTAYAASKAALMALARSVAAQ
YGKEGIRSNAIMIGFVLNEHAQKGVPQEIKQILLDQHLTPQLGSPKQIADVVSFLASDES
SFITGAVIPVDGGFTSHAPSMVPMREFFARMGSNKL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory