SitesBLAST
Comparing Ac3H11_2862 FitnessBrowser__acidovorax_3H11:Ac3H11_2862 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9LKJ1 3-hydroxyisobutyryl-CoA hydrolase 1; CoA-thioester hydrolase CHY1; EC 3.1.2.-; EC 3.1.2.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 93% coverage: 11:353/368 of query aligns to 9:353/378 of Q9LKJ1
- G70 (= G77) mutation to S: Loss of activity.
- E142 (= E148) mutation to A: Loss of activity.
- D150 (= D156) mutation to G: Reduced activity.
3bptA Crystal structure of human beta-hydroxyisobutyryl-coa hydrolase in complex with quercetin
37% identity, 95% coverage: 7:355/368 of query aligns to 1:347/362 of 3bptA
- active site: G67 (= G77), P84 (≠ E94), R88 (≠ T98), G115 (= G125), G118 (= G128), E138 (= E148), D146 (= D156)
- binding (2r)-3-hydroxy-2-methylpropanoic acid: G66 (= G76), G67 (= G77), I69 (= I79), E90 (= E100), G114 (= G124), G115 (= G125), E138 (= E148), D146 (= D156), V147 (= V157)
- binding 3,5,7,3',4'-pentahydroxyflavone: F25 (≠ A31), L26 (= L32), A28 (= A34), G66 (= G76), G67 (= G77), I69 (= I79), P137 (= P147), I141 (= I151), L319 (≠ A327)
4hdtA Crystal structure of a carnitinyl-coa dehydratase from mycobacterium thermoresistibile (see paper)
40% identity, 93% coverage: 12:354/368 of query aligns to 3:329/340 of 4hdtA
- active site: G64 (= G77), I69 (≠ L82), W84 (≠ F97), Y88 (= Y101), G112 (= G125), G115 (= G128), E135 (= E148), P142 (= P155), D143 (= D156), R283 (= R300)
- binding zinc ion: H28 (≠ L37), E42 (≠ Q51), E57 (≠ K66), E79 (≠ Q92), H93 (≠ L106), H185 (≠ A198)
Sites not aligning to the query:
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
33% identity, 51% coverage: 13:199/368 of query aligns to 6:186/260 of 2hw5C
- active site: A68 (≠ G77), M73 (≠ L82), S83 (≠ T98), L87 (= L103), G111 (= G125), E114 (≠ G128), P133 (= P147), E134 (= E148), T139 (≠ L153), P141 (= P155), G142 (≠ D156)
- binding crotonyl coenzyme a: K26 (≠ R30), A27 (= A31), L28 (= L32), A30 (= A34), K62 (= K66), I70 (= I79), F109 (≠ M123)
Sites not aligning to the query:
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
28% identity, 72% coverage: 13:277/368 of query aligns to 6:254/259 of 5zaiC
- active site: A65 (≠ G77), F70 (≠ L82), S82 (≠ F97), R86 (≠ Y101), G110 (= G125), E113 (≠ G128), P132 (= P147), E133 (= E148), I138 (≠ L153), P140 (= P155), G141 (≠ D156), A226 (= A246), F236 (≠ S255)
- binding coenzyme a: K24 (≠ A31), L25 (= L32), A63 (= A75), G64 (= G76), A65 (≠ G77), D66 (= D78), I67 (= I79), P132 (= P147), R166 (≠ T180), F248 (≠ T271), K251 (= K274)
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
31% identity, 51% coverage: 13:199/368 of query aligns to 4:184/258 of 1ey3A
- active site: A66 (≠ G77), M71 (≠ L82), S81 (≠ T98), L85 (= L103), G109 (= G125), E112 (≠ G128), P131 (= P147), E132 (= E148), T137 (≠ L153), P139 (= P155), G140 (≠ D156)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ R30), L26 (= L32), A28 (= A34), A64 (= A75), G65 (= G76), A66 (≠ G77), D67 (= D78), I68 (= I79), L85 (= L103), W88 (≠ L106), G109 (= G125), P131 (= P147), L135 (≠ I151), G140 (≠ D156)
Sites not aligning to the query:
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
31% identity, 51% coverage: 13:199/368 of query aligns to 6:186/260 of 1dubA
- active site: A68 (≠ G77), M73 (≠ L82), S83 (≠ T98), L87 (= L103), G111 (= G125), E114 (≠ G128), P133 (= P147), E134 (= E148), T139 (≠ L153), P141 (= P155), G142 (≠ D156)
- binding acetoacetyl-coenzyme a: K26 (≠ R30), A27 (= A31), L28 (= L32), A30 (= A34), A66 (= A75), A68 (≠ G77), D69 (= D78), I70 (= I79), Y107 (≠ I121), G110 (= G124), G111 (= G125), E114 (≠ G128), P133 (= P147), E134 (= E148), L137 (≠ I151), G142 (≠ D156)
Sites not aligning to the query:
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
31% identity, 51% coverage: 13:199/368 of query aligns to 36:216/290 of P14604
- E144 (≠ G128) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (= E148) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
6z1pBI mS93 (see paper)
30% identity, 49% coverage: 12:192/368 of query aligns to 23:201/1413 of 6z1pBI
- active site: T85 (≠ G77), S134 (≠ G125), E157 (= E148), D165 (= D156)
- binding : Y41 (≠ R30), K42 (≠ A31), Q43 (≠ L32), T45 (≠ A34), D47 (≠ S36), H49 (≠ S38), K83 (≠ A75), T85 (≠ G77), D86 (= D78), F87 (≠ I79), K88 (≠ R80), K92 (≠ Q84), L130 (≠ I121), K152 (= K143)
Sites not aligning to the query:
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
31% identity, 51% coverage: 13:199/368 of query aligns to 6:184/258 of 1mj3A
- active site: A68 (≠ G77), M73 (≠ L82), S83 (≠ T98), L85 (= L103), G109 (= G125), E112 (≠ G128), P131 (= P147), E132 (= E148), T137 (≠ L153), P139 (= P155), G140 (≠ D156)
- binding hexanoyl-coenzyme a: K26 (≠ R30), A27 (= A31), L28 (= L32), A30 (= A34), A66 (= A75), G67 (= G76), A68 (≠ G77), D69 (= D78), I70 (= I79), G109 (= G125), P131 (= P147), E132 (= E148), L135 (≠ I151), G140 (≠ D156)
Sites not aligning to the query:
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
31% identity, 51% coverage: 13:199/368 of query aligns to 5:180/254 of 2dubA
- active site: A67 (≠ G77), M72 (≠ L82), S82 (≠ T98), G105 (= G125), E108 (≠ G128), P127 (= P147), E128 (= E148), T133 (≠ L153), P135 (= P155), G136 (≠ D156)
- binding octanoyl-coenzyme a: K25 (≠ R30), A26 (= A31), L27 (= L32), A29 (= A34), A65 (= A75), A67 (≠ G77), D68 (= D78), I69 (= I79), K70 (≠ R80), G105 (= G125), E108 (≠ G128), P127 (= P147), E128 (= E148), G136 (≠ D156), A137 (≠ V157)
Sites not aligning to the query:
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
32% identity, 55% coverage: 13:215/368 of query aligns to 6:197/255 of 3q0jC
- active site: A65 (≠ G77), M70 (≠ Q88), T80 (= T98), F84 (≠ Y101), G108 (= G125), E111 (≠ G128), P130 (= P147), E131 (= E148), V136 (≠ L153), P138 (= P155), G139 (≠ D156)
- binding acetoacetyl-coenzyme a: Q23 (≠ R30), A24 (= A31), L25 (= L32), A27 (= A34), A63 (= A75), G64 (= G76), A65 (≠ G77), D66 (= D78), I67 (= I79), K68 (≠ R80), M70 (≠ Q88), F84 (≠ Y101), G107 (= G124), G108 (= G125), E111 (≠ G128), P130 (= P147), E131 (= E148), P138 (= P155), G139 (≠ D156), M140 (≠ V157)
Sites not aligning to the query:
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
32% identity, 55% coverage: 13:215/368 of query aligns to 6:197/255 of 3q0gC
- active site: A65 (≠ G77), M70 (≠ Q88), T80 (= T98), F84 (≠ Y101), G108 (= G125), E111 (≠ G128), P130 (= P147), E131 (= E148), V136 (≠ L153), P138 (= P155), G139 (≠ D156)
- binding coenzyme a: L25 (= L32), A63 (= A75), I67 (= I79), K68 (≠ R80), Y104 (≠ I121), P130 (= P147), E131 (= E148), L134 (≠ I151)
Sites not aligning to the query:
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
32% identity, 55% coverage: 13:215/368 of query aligns to 5:196/256 of 3h81A
- active site: A64 (≠ G77), M69 (≠ Q88), T79 (= T98), F83 (≠ Y101), G107 (= G125), E110 (≠ G128), P129 (= P147), E130 (= E148), V135 (≠ L153), P137 (= P155), G138 (≠ D156)
Sites not aligning to the query:
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
32% identity, 55% coverage: 13:215/368 of query aligns to 5:192/250 of 3q0gD
- active site: A64 (≠ G77), M69 (≠ L82), T75 (= T98), F79 (≠ Y101), G103 (= G125), E106 (≠ G128), P125 (= P147), E126 (= E148), V131 (≠ L153), P133 (= P155), G134 (≠ D156)
Sites not aligning to the query:
O53561 Enoyl-CoA hydratase EchA19; EC 4.2.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
30% identity, 56% coverage: 12:216/368 of query aligns to 9:209/266 of O53561
- K135 (= K143) modified: N6-succinyllysine; mutation to E: Nearly wild-type levels of succinylation in vitro, reduces specific activity 8-fold.
- 135:142 (vs. 143:150, 25% identical) mutation to EFGISEAE: Very low levels of succinylation in vitro, reduces specific activity 15-fold.
- K142 (≠ A150) modified: N6-succinyllysine; mutation to E: About 50% succinylation in vitro, reduces specific activity 7-fold.
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
29% identity, 42% coverage: 16:168/368 of query aligns to 5:144/692 of 6iunB
Sites not aligning to the query:
- active site: 248, 407, 428, 440, 478
- binding nicotinamide-adenine-dinucleotide: 300, 301, 302, 321, 322, 365, 377, 378, 380, 384, 388, 405, 407
Q9P4U9 Enoyl-CoA hydratase AKT3-1; AF-toxin biosynthesis protein 3-1; EC 4.2.1.17 from Alternaria alternata (Alternaria rot fungus) (Torula alternata) (see paper)
26% identity, 72% coverage: 21:286/368 of query aligns to 25:275/296 of Q9P4U9
Sites not aligning to the query:
- 294:296 Peroxisomal targeting signal type 1
3p85A Crystal structure enoyl-coa hydratase from mycobacterium avium (see paper)
30% identity, 51% coverage: 13:200/368 of query aligns to 3:168/224 of 3p85A
- active site: L62 (≠ G77), L67 (= L93), P68 (≠ E94), G92 (= G125), E95 (≠ G128), T114 (≠ P147), H115 (≠ E148), L120 (= L153), P122 (= P155), T123 (≠ D156)
- binding calcium ion: D43 (= D53), D45 (≠ R55)
Sites not aligning to the query:
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
28% identity, 53% coverage: 16:209/368 of query aligns to 10:197/261 of 5jbxB
- active site: A67 (≠ G77), R72 (≠ A85), L84 (≠ F97), R88 (≠ Y101), G112 (= G125), E115 (≠ G128), T134 (≠ P147), E135 (= E148), I140 (≠ L153), P142 (= P155), G143 (≠ D156)
- binding coenzyme a: S24 (≠ R30), R25 (≠ A31), R26 (≠ L32), A28 (= A34), A65 (= A75), D68 (= D78), L69 (= L82), K70 (≠ H83), L110 (≠ M123), G111 (= G124), T134 (≠ P147), E135 (= E148), L138 (≠ I151), R168 (≠ T180)
Sites not aligning to the query:
Query Sequence
>Ac3H11_2862 FitnessBrowser__acidovorax_3H11:Ac3H11_2862
MTETVVSEVVSDVLSEVRGQVGFITLNRPRALNALSLSMVRDLMAILLAWQNDARVLAVA
IRGSNKEGPFGAFCAGGDIRFLHQAGSQGNPQLEDFFTEEYALNHLIHNYAKPYIAFMDG
IVMGGGMGISQGAALRVVTERTKMAMPETAIGLFPDVGGGYFLSRCPGRVGEWLALTGDT
IGAGDAIDSQLADGCLPADQQAAVWEALATQTFASGAAVKDYVASKFIAIEPMLSGAKGQ
IDQYFALPTVGEIVSALESADSDWARATAATLRKRSPLMLNVVLEQIRRARGMGLADDLR
MERDMVRHCFYLRPGQSETVEGIRALAVDKDHAPKWNPARIEDVTPEMVAPFFASPWPAH
SHPLAALV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory