SitesBLAST
Comparing Ac3H11_2872 FitnessBrowser__acidovorax_3H11:Ac3H11_2872 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
41% identity, 89% coverage: 44:421/426 of query aligns to 42:434/478 of Q47945
Sites not aligning to the query:
- 1:36 signal peptide
- 37 modified: Pyrrolidone carboxylic acid
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
41% identity, 89% coverage: 44:421/426 of query aligns to 4:396/433 of 8gy2B
- binding heme c: C18 (= C58), C21 (= C61), H22 (= H62), T46 (≠ S86), I48 (≠ L88), Y59 (≠ W99), L68 (≠ M108), R73 (≠ S113), V79 (≠ L119), Y80 (= Y120), M83 (≠ F123), F88 (≠ Y128), R126 (≠ Q165), H165 (= H203), C166 (= C204), C169 (= C207), H170 (= H208), I201 (≠ Y234), A202 (= A235), P203 (= P236), L205 (= L238), W216 (= W249), F224 (≠ L257), A234 (≠ S267), V235 (= V268), F236 (≠ L269), F236 (≠ L269), M239 (= M272), N301 (≠ H327), C302 (= C328), C305 (= C331), H306 (= H332), M316 (≠ A342), F317 (= F343), P318 (= P344), L320 (= L346), P324 (≠ R350), G342 (= G368), S352 (≠ R378), V354 (≠ H380), M356 (= M382), F359 (= F385), M375 (≠ V401)
- binding ubiquinone-10: C21 (= C61), L34 (≠ R74), P39 (= P79), P81 (= P121), L129 (= L168), W132 (= W171), E168 (≠ A206), R173 (= R211), I197 (≠ V230), D241 (≠ E274)
Sites not aligning to the query:
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
37% identity, 88% coverage: 32:404/426 of query aligns to 27:410/440 of 8gy3A
- binding heme c: Y52 (≠ N57), C53 (= C58), C56 (= C61), H57 (= H62), S84 (= S86), I86 (≠ L88), W97 (= W99), F102 (= F104), L117 (= L119), F121 (= F123), F126 (≠ Y128), R163 (≠ Q165), C203 (= C204), C206 (= C207), H207 (= H208), A232 (= A235), P233 (= P236), L235 (= L238), W245 (= W249), Y253 (≠ L257), L254 (= L258), G263 (= G266), S264 (= S267), M269 (= M272), Y292 (≠ L295), C337 (= C328), C340 (= C331), H341 (= H332), P353 (= P344), L355 (= L346), N358 (= N349), N359 (≠ R350), V372 (= V363), I377 (≠ A372), G382 (≠ P377), Q383 (≠ R378), I386 (vs. gap), M388 (= M382), F391 (= F385)
- binding ubiquinone-10: E55 (≠ A60), T76 (= T78), F78 (= F80), Y118 (= Y120), P119 (= P121), I160 (≠ Y162), G166 (≠ A167), Q167 (≠ L168), F169 (≠ V170), W170 (= W171), H202 (= H203), R210 (= R211), L213 (= L214)
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
36% identity, 88% coverage: 46:421/426 of query aligns to 1:386/418 of 7w2jC
- binding heme c: C13 (= C58), C16 (= C61), H17 (= H62), T42 (≠ S86), I44 (≠ L88), Y55 (≠ W99), L75 (= L119), Y76 (= Y120), A78 (= A122), M79 (≠ F123), R122 (≠ Q165), H161 (= H203), C162 (= C204), C165 (= C207), H166 (= H208), A191 (= A235), P192 (= P236), R223 (≠ S267), P227 (= P271), M228 (= M272), V289 (≠ H327), C290 (= C328), C293 (= C331), H294 (= H332), Y305 (≠ A342), Y306 (≠ F343), P307 (= P344), L309 (= L346), N312 (= N349), T313 (≠ R350), T314 (≠ A351), D322 (≠ N359), I327 (≠ V364), V331 (≠ L370), R333 (≠ A372), I340 (≠ P379), M342 (= M382), P343 (= P383), F345 (= F385)
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
35% identity, 88% coverage: 46:421/426 of query aligns to 1:400/413 of 8jejC
- binding heme c: C13 (= C58), C16 (= C61), H17 (= H62), T42 (≠ S86), I44 (≠ L88), F60 (= F104), L64 (≠ M108), L75 (= L119), Y76 (= Y120), M79 (≠ F123), P80 (= P124), Y84 (= Y128), R122 (≠ Q165), C162 (= C204), C165 (= C207), H166 (= H208), I186 (≠ V230), W189 (= W233), A191 (= A235), P192 (= P236), I194 (≠ L238), W205 (= W249), Y213 (≠ L257), R223 (≠ S267), M228 (= M272), V303 (≠ H327), C304 (= C328), C307 (= C331), H308 (= H332), Y320 (≠ F343), P321 (= P344), L323 (= L346), T327 (≠ R350), T328 (≠ A351), D336 (≠ N359), I341 (≠ V364), V345 (≠ L370), R347 (≠ A372), I354 (≠ P379), M356 (= M382), F359 (= F385), I376 (≠ V397)
- binding ubiquinone-10: M36 (≠ F80), P77 (= P121), S124 (≠ A167), W128 (= W171), C165 (= C207), L173 (≠ G215)
Sites not aligning to the query:
2zooA Crystal structure of nitrite reductase from pseudoalteromonas haloplanktis tac125
37% identity, 24% coverage: 320:421/426 of query aligns to 339:438/438 of 2zooA
- binding protoporphyrin ix containing fe: C347 (= C328), C350 (= C331), H351 (= H332), F362 (= F343), P363 (= P344), P364 (≠ A345), L365 (= L346), S368 (≠ N349), Y370 (≠ A351), I382 (≠ V364), L386 (≠ G368), S387 (≠ Y369), G388 (≠ L370), I390 (≠ A372), V392 (≠ A374), Y397 (≠ P379), N398 (≠ H380), G399 (= G381), V400 (≠ M382), M401 (≠ P383)
Sites not aligning to the query:
- active site: 81, 84, 86, 121, 122, 130, 135, 227, 249, 250, 276
- binding copper (ii) ion: 81, 86, 121, 122, 130, 135
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase
39% identity, 24% coverage: 321:421/426 of query aligns to 23:121/121 of 8hddB
- binding protoporphyrin ix containing fe: C30 (= C328), C33 (= C331), H34 (= H332), Y46 (≠ F343), P47 (= P344), T54 (≠ A351), V66 (= V363), I67 (≠ V364), R73 (≠ A372), I80 (≠ H380), M82 (= M382), P83 (= P383)
1r0qA Characterization of the conversion of the malformed, recombinant cytochrome rc552 to a 2-formyl-4-vinyl (spirographis) heme (see paper)
41% identity, 26% coverage: 318:426/426 of query aligns to 1:110/130 of 1r0qA
- binding 2-formyl-protoporphryn ix: C13 (= C331), H14 (= H332), P26 (= P344), L28 (= L346), H31 (≠ N349), Y44 (vs. gap), V48 (= V363), Q54 (≠ Y369), G55 (≠ L370), G66 (= G381), M68 (= M382)
Sites not aligning to the query:
1qyzA Characterization of the malformed, recombinant cytochrome rc552 (see paper)
41% identity, 26% coverage: 318:426/426 of query aligns to 1:110/130 of 1qyzA
- binding 2-acetyl-protoporphyrin ix: Y7 (= Y324), C10 (= C328), C13 (= C331), H14 (= H332), P26 (= P344), H31 (≠ N349), Y44 (vs. gap), Q54 (≠ Y369), G55 (≠ L370), G66 (= G381), M68 (= M382), F71 (= F385)
Sites not aligning to the query:
1c52A Thermus thermophilus cytochrome-c552: a new highly thermostable cytochromE-C structure obtained by mad phasing (see paper)
41% identity, 26% coverage: 318:426/426 of query aligns to 2:111/131 of 1c52A
- binding protoporphyrin ix containing fe: C11 (= C328), C14 (= C331), H15 (= H332), F26 (= F343), P27 (= P344), L29 (= L346), H32 (≠ N349), Y45 (vs. gap), L54 (≠ G368), Q55 (≠ Y369), G56 (≠ L370), G67 (= G381), M69 (= M382), F72 (= F385)
Sites not aligning to the query:
1dt1A Thermus thermophilus cytochrome c552 synthesized by escherichia coli (see paper)
41% identity, 25% coverage: 320:426/426 of query aligns to 2:109/129 of 1dt1A
- binding heme c: C9 (= C328), C12 (= C331), H13 (= H332), P25 (= P344), H30 (≠ N349), Y43 (vs. gap), V47 (= V363), Q53 (≠ Y369), G54 (≠ L370), G65 (= G381), M67 (= M382), F70 (= F385)
Sites not aligning to the query:
4ax3D Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.6 a resolution (see paper)
35% identity, 24% coverage: 320:421/426 of query aligns to 355:455/457 of 4ax3D
- binding heme c: C363 (= C328), C366 (= C331), H367 (= H332), P379 (= P344), P380 (≠ A345), L381 (= L346), S384 (≠ N349), F386 (≠ A351), N403 (vs. gap), G404 (= G368), S415 (≠ H380), M417 (= M382), M420 (≠ F385)
Sites not aligning to the query:
- active site: 93, 96, 98, 133, 134, 142, 147, 239, 261, 262, 288
- binding copper (ii) ion: 93, 98, 133, 134, 142, 147
5oboA Crystal structure of nitrite bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii
35% identity, 24% coverage: 320:421/426 of query aligns to 353:453/456 of 5oboA
- binding heme c: T360 (≠ H327), C361 (= C328), C364 (= C331), H365 (= H332), P377 (= P344), P378 (≠ A345), L379 (= L346), S382 (≠ N349), F384 (≠ A351), I395 (≠ V363), N401 (vs. gap), G402 (= G368), S413 (≠ H380), M415 (= M382), M418 (≠ F385)
Sites not aligning to the query:
- active site: 91, 94, 96, 131, 132, 140, 145, 237, 259, 260, 286
- binding copper (ii) ion: 91, 96, 131, 132, 140, 145
- binding nitrite ion: 94, 96, 131
6fjaA Crystal structure of t2d three-domain heme-cu nitrite reductase from ralstonia pickettii
35% identity, 24% coverage: 320:421/426 of query aligns to 352:452/455 of 6fjaA
- binding protoporphyrin ix containing fe: T359 (≠ H327), C360 (= C328), C363 (= C331), H364 (= H332), P376 (= P344), P377 (≠ A345), L378 (= L346), F383 (≠ A351), N400 (vs. gap), G401 (= G368), Y410 (≠ R378), S412 (≠ H380), M414 (= M382), M417 (≠ F385)
Sites not aligning to the query:
- active site: 90, 93, 95, 130, 131, 139, 144, 236, 258, 259, 285
- binding copper (ii) ion: 90, 131, 139, 144
Query Sequence
>Ac3H11_2872 FitnessBrowser__acidovorax_3H11:Ac3H11_2872
MKRILWTISCALAALGMAAAAVVTLNLRGEEPLPATETLQSTPALVQRGEYLARVGNCMA
CHTTQGGAPFAGGRGIETPFGVVHSSNLTPDKAQGIGSWTSAEFWRAMHHGRSKDGRLLY
PAFPYPNYTQVTREDSDAIFAYLQSQPAVAEPNRAHALRFPYNTQAALGVWRALFFTPGA
PQPEATQSAEYNRGAYLVNGLGHCTACHTPRNALGATTDAKAFTGGLIPVQNWYAPALNA
AHEAGVKEWKTDDVVALLKTGVAPQGSVLGPMAEVVFRSAQHLSDADARAMAVYLQALPQ
QEHRALAAGAAPPASALARGAKVYEQHCAQCHGDQGQGEPGAFPALAGNRAVTLADPTNL
VRVVLQGGYLPATAGNPRPHGMPPFQQLLSDEDIAAVTTLVRNSWGNRAPGVGTIEVYRA
RERRGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory