Comparing Ac3H11_2881 FitnessBrowser__acidovorax_3H11:Ac3H11_2881 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
42% identity, 100% coverage: 1:494/496 of query aligns to 1:493/501 of P04983
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 45% coverage: 5:228/496 of query aligns to 2:228/343 of P30750
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
34% identity, 43% coverage: 8:220/496 of query aligns to 5:215/240 of 4ymuJ
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
33% identity, 45% coverage: 5:228/496 of query aligns to 3:229/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
33% identity, 45% coverage: 5:228/496 of query aligns to 3:229/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
33% identity, 45% coverage: 5:228/496 of query aligns to 3:229/344 of 3tuiC
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
29% identity, 51% coverage: 7:258/496 of query aligns to 14:260/265 of P07821
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 44% coverage: 5:220/496 of query aligns to 3:215/241 of 4u00A
7mdyC Lolcde nucleotide-bound
32% identity, 44% coverage: 3:221/496 of query aligns to 1:222/226 of 7mdyC
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
32% identity, 44% coverage: 3:221/496 of query aligns to 4:225/233 of P75957
7arlD Lolcde in complex with lipoprotein and adp (see paper)
32% identity, 44% coverage: 3:221/496 of query aligns to 1:222/222 of 7arlD
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 43% coverage: 8:222/496 of query aligns to 8:231/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 43% coverage: 8:222/496 of query aligns to 8:231/254 of 1g6hA
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
31% identity, 44% coverage: 3:221/496 of query aligns to 3:224/229 of 7v8iD
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 44% coverage: 5:220/496 of query aligns to 4:217/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 44% coverage: 5:220/496 of query aligns to 4:217/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 44% coverage: 5:220/496 of query aligns to 4:217/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 44% coverage: 5:220/496 of query aligns to 4:217/242 of 2oljA
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
32% identity, 43% coverage: 5:219/496 of query aligns to 2:215/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
32% identity, 43% coverage: 5:219/496 of query aligns to 2:215/219 of 8w6iD
>Ac3H11_2881 FitnessBrowser__acidovorax_3H11:Ac3H11_2881
MSVAVEFRNVTKEFGPVRVLHGVGFALQPGRVYGLLGENGAGKSTLMKILAGYESPTTGE
VVVDGAVRAPGGGSRAAEAQGIVLIHQEFNLADDLTIAQNIFLGHEIKRGLFLDDKAMRE
KTREALAKVGLPLDPDTRVRKLIVAEKQLVEIARALARNARLLIMDEPTATLTPGETERL
FALMAGLKAAGVTIIYISHKLDEVERTTDEVVVMRDGLLVAREATASVTRRQMANLMVGR
ELADLFPPKLPAPQDGAPAITVRGLTVPGWAEGVDFEVRRGEILGFAGLVGAGRTELFEG
LLGLRPRTAGTVEIAGQPVQLKSPRDAARHGLTYLSEDRKGKGLHVHFGLRPNLTLMALE
RYAKPWLDPAAEQAALREAVQEFGIRTGSLEVRASSLSGGNQQKLALAKVLHPGPSVVVL
DEPTRGVDVGAKREIYHLVQRLAEQGLAVIVISSELMELIGLCHRVAVMRAGRLQTTLQE
PHLTEEELIAHATGTR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory