SitesBLAST
Comparing Ac3H11_2934 FitnessBrowser__acidovorax_3H11:Ac3H11_2934 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
48% identity, 99% coverage: 4:470/474 of query aligns to 6:465/465 of 3pm9A
- active site: A149 (= A148), L159 (≠ N158)
- binding flavin-adenine dinucleotide: P69 (= P66), Q70 (= Q67), G71 (= G68), G72 (= G69), N73 (= N70), T74 (= T71), G75 (= G72), L76 (= L73), G79 (= G76), Q80 (≠ S77), L91 (= L90), L133 (= L132), G134 (≠ A133), A135 (= A134), C139 (= C138), T140 (= T139), G142 (= G141), G143 (= G142), S146 (≠ G145), T147 (= T146), A149 (= A148), G150 (= G149), E200 (= E199), G201 (= G200), I205 (= I204), I206 (= I205), E423 (= E428)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
40% identity, 96% coverage: 14:470/474 of query aligns to 23:465/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (= W30), P76 (= P66), G78 (= G68), G79 (= G69), N80 (= N70), T81 (= T71), G82 (= G72), M83 (≠ L73), G86 (= G76), S87 (= S77), L140 (= L132), A142 (= A134), C146 (= C138), H147 (≠ T139), G150 (= G142), N151 (= N143), A153 (≠ G145), T154 (= T146), G208 (= G200), I212 (= I204), I213 (= I205), E423 (= E428), N460 (= N465)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
40% identity, 96% coverage: 14:470/474 of query aligns to 22:464/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R331), T337 (≠ P335), K348 (= K346), Y379 (≠ F379), H381 (= H381), H388 (= H388), H423 (= H429)
- binding flavin-adenine dinucleotide: W39 (= W30), P75 (= P66), Q76 (= Q67), G77 (= G68), G78 (= G69), N79 (= N70), T80 (= T71), G81 (= G72), M82 (≠ L73), G85 (= G76), S86 (= S77), L139 (= L132), G140 (≠ A133), A141 (= A134), C145 (= C138), G149 (= G142), N150 (= N143), A152 (≠ G145), T153 (= T146), G157 (= G150), G207 (= G200), I212 (= I205), E422 (= E428), N459 (= N465)
- binding zinc ion: H381 (= H381), H388 (= H388), E422 (= E428)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
40% identity, 96% coverage: 14:470/474 of query aligns to 22:464/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (= W30), P75 (= P66), G77 (= G68), G78 (= G69), N79 (= N70), T80 (= T71), G81 (= G72), G85 (= G76), S86 (= S77), L139 (= L132), G140 (≠ A133), A141 (= A134), C145 (= C138), H146 (≠ T139), G148 (= G141), G149 (= G142), N150 (= N143), A152 (≠ G145), T153 (= T146), A155 (= A148), E206 (= E199), G207 (= G200), I211 (= I204), I212 (= I205), E422 (= E428), N459 (= N465)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R331), T337 (≠ P335), K348 (= K346), Y379 (≠ F379), H381 (= H381), H388 (= H388), H423 (= H429)
- binding zinc ion: H381 (= H381), H388 (= H388), E422 (= E428)
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
40% identity, 96% coverage: 14:470/474 of query aligns to 22:464/466 of 6lpqA
- binding flavin-adenine dinucleotide: W39 (= W30), P75 (= P66), G77 (= G68), G78 (= G69), N79 (= N70), T80 (= T71), G81 (= G72), G85 (= G76), S86 (= S77), L139 (= L132), G140 (≠ A133), A141 (= A134), C145 (= C138), H146 (≠ T139), G149 (= G142), N150 (= N143), A152 (≠ G145), T153 (= T146), A155 (= A148), G157 (= G150), E206 (= E199), G207 (= G200), I211 (= I204), I212 (= I205), E422 (= E428), N459 (= N465)
- binding d-malate: M82 (≠ L73), R333 (= R331), T337 (≠ P335), K348 (= K346), Y379 (≠ F379), H381 (= H381), H388 (= H388), E422 (= E428), H423 (= H429)
- binding zinc ion: H381 (= H381), H388 (= H388), E422 (= E428)
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
40% identity, 96% coverage: 14:470/474 of query aligns to 22:464/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R331), T337 (≠ P335), K348 (= K346), Y379 (≠ F379), H381 (= H381), H388 (= H388), N390 (= N390), H423 (= H429)
- binding flavin-adenine dinucleotide: W39 (= W30), P75 (= P66), G77 (= G68), G78 (= G69), N79 (= N70), T80 (= T71), G81 (= G72), M82 (≠ L73), G85 (= G76), S86 (= S77), L139 (= L132), G140 (≠ A133), A141 (= A134), C145 (= C138), G149 (= G142), N150 (= N143), A152 (≠ G145), T153 (= T146), A155 (= A148), G157 (= G150), G207 (= G200), I212 (= I205), E422 (= E428), H423 (= H429)
- binding zinc ion: H381 (= H381), H388 (= H388), E422 (= E428)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
40% identity, 96% coverage: 14:470/474 of query aligns to 75:517/521 of Q8N465
- S109 (≠ T47) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V65) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G69) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ V87) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (= M93) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (= C112) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P129) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (≠ G145) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (= A171) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G173) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ N320) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R331) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ P335) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ N344) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (= K346) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ D364) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ I371) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H381) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G383) to V: slight reduction in catalytic activity
- N439 (= N386) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H388) binding ; mutation to A: Loss of catalytic activity.
- N443 (= N390) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (= V391) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (= A393) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E428) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H429) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G430) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
32% identity, 98% coverage: 5:470/474 of query aligns to 32:496/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
32% identity, 91% coverage: 41:469/474 of query aligns to 48:463/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P66), G75 (= G68), S76 (≠ G69), G77 (≠ N70), T78 (= T71), G79 (= G72), L80 (= L73), A83 (≠ G76), C84 (≠ S77), P137 (≠ A133), G138 (≠ A134), E139 (= E135), A142 (≠ C138), T143 (= T139), G146 (= G142), N147 (= N143), S149 (≠ G145), T150 (= T146), A152 (= A148), G153 (= G149), E203 (= E199), G204 (= G200), I209 (= I205), E422 (= E428), H423 (= H429)
- binding fe (iii) ion: H377 (= H381), H384 (= H388), E422 (= E428)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 99% coverage: 1:471/474 of query aligns to 1:457/459 of P9WIT1
- K354 (≠ A358) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
30% identity, 99% coverage: 4:470/474 of query aligns to 5:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P66), G70 (= G68), T71 (≠ G69), G72 (≠ N70), T73 (= T71), G74 (= G72), G78 (= G76), V79 (≠ S77), L90 (= L90), P132 (≠ L132), G133 (≠ A133), A134 (= A134), G140 (= G142), M141 (≠ N143), A143 (≠ G145), T144 (= T146), A146 (= A148), S147 (≠ G149), E200 (= E199), G201 (= G200), I206 (= I205), W322 (vs. gap), E413 (= E428), H414 (= H429), N450 (= N465)
- binding lactic acid: R318 (= R331), H369 (= H381), H376 (= H388), H414 (= H429)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E413 (= E428)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
30% identity, 99% coverage: 4:470/474 of query aligns to 5:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R331), W322 (vs. gap), H369 (= H381), H376 (= H388), H413 (= H429)
- binding flavin-adenine dinucleotide: E32 (≠ W30), P68 (= P66), G70 (= G68), T71 (≠ G69), G72 (≠ N70), T73 (= T71), G74 (= G72), G78 (= G76), V79 (≠ S77), L90 (= L90), P132 (≠ L132), G133 (≠ A133), A134 (= A134), G140 (= G142), M141 (≠ N143), A143 (≠ G145), T144 (= T146), A146 (= A148), S147 (≠ G149), E200 (= E199), G201 (= G200), I206 (= I205), W322 (vs. gap), E412 (= E428), H413 (= H429), N449 (= N465)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E412 (= E428)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
30% identity, 99% coverage: 4:470/474 of query aligns to 5:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R331), W322 (vs. gap), S336 (≠ K346), H369 (= H381), H376 (= H388), H413 (= H429)
- binding flavin-adenine dinucleotide: P68 (= P66), G70 (= G68), T71 (≠ G69), G72 (≠ N70), T73 (= T71), G74 (= G72), G78 (= G76), V79 (≠ S77), L90 (= L90), P132 (≠ L132), G133 (≠ A133), A134 (= A134), G140 (= G142), M141 (≠ N143), A143 (≠ G145), T144 (= T146), A146 (= A148), S147 (≠ G149), E200 (= E199), G201 (= G200), I206 (= I205), E412 (= E428), N449 (= N465)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E412 (= E428)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
30% identity, 99% coverage: 4:470/474 of query aligns to 5:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L73), R317 (= R331), W321 (vs. gap), H368 (= H381), H375 (= H388), H413 (= H429)
- binding flavin-adenine dinucleotide: P68 (= P66), G70 (= G68), T71 (≠ G69), G72 (≠ N70), T73 (= T71), G74 (= G72), G78 (= G76), V79 (≠ S77), L90 (= L90), P132 (≠ L132), G133 (≠ A133), A134 (= A134), G140 (= G142), M141 (≠ N143), A143 (≠ G145), T144 (= T146), A146 (= A148), S147 (≠ G149), E200 (= E199), G201 (= G200), I206 (= I205), W321 (vs. gap), Y322 (vs. gap), E412 (= E428), H413 (= H429), N449 (= N465)
- binding manganese (ii) ion: H368 (= H381), H375 (= H388), E412 (= E428)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
30% identity, 99% coverage: 4:470/474 of query aligns to 5:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R331), H369 (= H381), H376 (= H388), H414 (= H429)
- binding flavin-adenine dinucleotide: P68 (= P66), G70 (= G68), T71 (≠ G69), G72 (≠ N70), T73 (= T71), G74 (= G72), G78 (= G76), V79 (≠ S77), L90 (= L90), P132 (≠ L132), G133 (≠ A133), A134 (= A134), G140 (= G142), M141 (≠ N143), A143 (≠ G145), T144 (= T146), A146 (= A148), S147 (≠ G149), E200 (= E199), G201 (= G200), I206 (= I205), W322 (vs. gap), E413 (= E428), H414 (= H429), N450 (= N465)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E413 (= E428)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
30% identity, 99% coverage: 4:470/474 of query aligns to 5:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ W30), P68 (= P66), G70 (= G68), T71 (≠ G69), G72 (≠ N70), T73 (= T71), G74 (= G72), G78 (= G76), V79 (≠ S77), L90 (= L90), P132 (≠ L132), G133 (≠ A133), A134 (= A134), G140 (= G142), M141 (≠ N143), A143 (≠ G145), T144 (= T146), A146 (= A148), S147 (≠ G149), E200 (= E199), G201 (= G200), I206 (= I205), W323 (vs. gap), E414 (= E428), H415 (= H429), N451 (= N465)
- binding manganese (ii) ion: H370 (= H381), H377 (= H388), E414 (= E428)
- binding pyruvic acid: R319 (= R331), H370 (= H381), H377 (= H388), H415 (= H429)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
30% identity, 99% coverage: 4:470/474 of query aligns to 5:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ W30), P68 (= P66), G70 (= G68), T71 (≠ G69), G72 (≠ N70), T73 (= T71), G74 (= G72), G78 (= G76), V79 (≠ S77), L90 (= L90), P132 (≠ L132), G133 (≠ A133), A134 (= A134), G140 (= G142), M141 (≠ N143), A143 (≠ G145), T144 (= T146), A146 (= A148), S147 (≠ G149), E200 (= E199), G201 (= G200), I206 (= I205), W322 (vs. gap), E413 (= E428), H414 (= H429), N450 (= N465)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R331), H369 (= H381), H376 (= H388), H414 (= H429)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E413 (= E428)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
30% identity, 99% coverage: 4:470/474 of query aligns to 5:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R331), W322 (vs. gap), H369 (= H381), H376 (= H388), H414 (= H429)
- binding flavin-adenine dinucleotide: P68 (= P66), G70 (= G68), T71 (≠ G69), G72 (≠ N70), T73 (= T71), G74 (= G72), G78 (= G76), V79 (≠ S77), L90 (= L90), P132 (≠ L132), G133 (≠ A133), A134 (= A134), G140 (= G142), M141 (≠ N143), A143 (≠ G145), T144 (= T146), A146 (= A148), S147 (≠ G149), E200 (= E199), G201 (= G200), I206 (= I205), W322 (vs. gap), E413 (= E428), N450 (= N465)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E413 (= E428)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
30% identity, 99% coverage: 4:470/474 of query aligns to 5:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P66), G70 (= G68), T71 (≠ G69), G72 (≠ N70), T73 (= T71), G74 (= G72), G78 (= G76), V79 (≠ S77), L90 (= L90), P132 (≠ L132), G133 (≠ A133), A134 (= A134), G140 (= G142), M141 (≠ N143), A143 (≠ G145), T144 (= T146), A146 (= A148), S147 (≠ G149), E200 (= E199), G201 (= G200), I206 (= I205), Y324 (vs. gap), H370 (= H381), E414 (= E428), N451 (= N465)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R331), W323 (vs. gap), H415 (= H429)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
30% identity, 99% coverage: 4:470/474 of query aligns to 5:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R331), W323 (vs. gap), H370 (= H381), H415 (= H429)
- binding flavin-adenine dinucleotide: P68 (= P66), G70 (= G68), T71 (≠ G69), G72 (≠ N70), T73 (= T71), G74 (= G72), G78 (= G76), V79 (≠ S77), L90 (= L90), P132 (≠ L132), G133 (≠ A133), A134 (= A134), G140 (= G142), M141 (≠ N143), A143 (≠ G145), T144 (= T146), A146 (= A148), S147 (≠ G149), E200 (= E199), G201 (= G200), I206 (= I205), H370 (= H381), E414 (= E428), N451 (= N465)
Query Sequence
>Ac3H11_2934 FitnessBrowser__acidovorax_3H11:Ac3H11_2934
MTTLLDTLRAIVGPTHVITEGDLTAWEQDWRRRVRGKALAVVRPANTQEVAAVVKACAAV
GTAIVPQGGNTGLAVGSTPDDSGTQIVLSLTRMNAVRSVDTDNLTMTVEAGCILQNLQDV
AQNAGVLFPLSLAAEGSCTIGGNLGTNAGGTQVVRYGNARDLCLGLEVVTAQGEVWDGLK
GLRKDNTGYDLRDLFIGSEGTLGIITAATMKLYPQPAANLTAWAAAPSMEHAVALLGLAH
KQLGAGLTGFEVMGQFALSLVGKHMPQLRVPFLGDDNAPWCVLLENSDSESEEHARARFE
SLLETAFEMGCVTDAVVAENLTQAHQLWHIRESIPLAQAEEGLNIKHDISIQISRIPAFV
AHTDAVLQREIPGVRLVNFGHLGDGNLHYNVQAPAAGDPKAFLREQEARVNHLVYEAVAE
FGGSFSAEHGIGELKADKLAKYQSPVALGMMRAIKQALDPQGVMNPGRVLGHPG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory