Comparing Ac3H11_2937 FitnessBrowser__acidovorax_3H11:Ac3H11_2937 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
49% identity, 99% coverage: 1:511/515 of query aligns to 1:479/484 of P09099
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
47% identity, 99% coverage: 1:511/515 of query aligns to 1:471/476 of 2itmA
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
24% identity, 100% coverage: 3:515/515 of query aligns to 6:488/492 of 3ll3A
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
25% identity, 100% coverage: 3:515/515 of query aligns to 5:486/490 of 3ll3B
3i8bA The crystal structure of xylulose kinase from bifidobacterium adolescentis
26% identity, 91% coverage: 37:503/515 of query aligns to 36:503/506 of 3i8bA
3kzbA Crystal structure of xylulokinase from chromobacterium violaceum
26% identity, 90% coverage: 5:468/515 of query aligns to 9:449/498 of 3kzbA
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
23% identity, 96% coverage: 3:494/515 of query aligns to 6:476/496 of P18157
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
23% identity, 96% coverage: 3:494/515 of query aligns to 2:461/485 of 6k76A
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
24% identity, 91% coverage: 3:471/515 of query aligns to 7:452/499 of 3ge1A
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
24% identity, 91% coverage: 3:471/515 of query aligns to 6:451/498 of Q5HGD2
6udeB Crystal structure of glycerol kinase from elizabethkingia anophelis nuhp1 in complex with adp and glycerol
23% identity, 91% coverage: 1:471/515 of query aligns to 4:448/495 of 6udeB
1gllO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
21% identity, 91% coverage: 3:471/515 of query aligns to 6:447/494 of 1gllO
1gljO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
21% identity, 91% coverage: 3:471/515 of query aligns to 6:447/494 of 1gljO
1bwfO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
21% identity, 91% coverage: 3:471/515 of query aligns to 6:447/494 of 1bwfO
P0A6F3 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Escherichia coli (strain K12) (see 10 papers)
21% identity, 91% coverage: 3:471/515 of query aligns to 8:453/502 of P0A6F3
Sites not aligning to the query:
1glfO Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
21% identity, 91% coverage: 3:471/515 of query aligns to 6:451/498 of 1glfO
1bo5O Crystal structure of the complex between escherichia coli glycerol kinase and the allosteric regulator fructose 1,6-bisphosphate. (see paper)
21% identity, 91% coverage: 3:471/515 of query aligns to 6:451/498 of 1bo5O
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
23% identity, 91% coverage: 3:471/515 of query aligns to 8:452/501 of O34154
Sites not aligning to the query:
1bu6Y Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
21% identity, 91% coverage: 3:471/515 of query aligns to 6:451/499 of 1bu6Y
1gldG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
21% identity, 91% coverage: 3:471/515 of query aligns to 4:442/489 of 1gldG
>Ac3H11_2937 FitnessBrowser__acidovorax_3H11:Ac3H11_2937
MYLGIDLGTSGVKLLLLNGAQTLVATADAAVPQHRPQPTWSEQNPADWMAAVEAAVAQLR
AQAPAAWAQVRGIGLSGHMHGAVVLGAQGHVLRPAILWNDGRASAECAQLEDAVPTSRQI
TGNLAMPGFTAPKLLWLRTHEPAVFAQVRTVLLPKDWLRLQLTGDAVSDMSDASGTLWLD
VQARTWSPAMLQACGLDVSHMPKLAEGSAPTGTLRSDVARRWGLGEGVVVAAGAGDNAAS
AVGVGARTAGQGFVSLGTSGVVFRVTDAFAPATERAVHAFAHALPQRWHHMSVMLSAASA
FGWVTRLTGRSDEAQLSDAVGALSTSRQAQAPLFLPYLSGERTPHNNAAATGVFMGLRAE
HEAADLAYAVMEGVGFGLLDGLNAMRAAGAGQGRAAGEAVGSTTPVQAELVEARTAPGAT
DSALALVGGGARSNPWAQLLASALGTPLQRPQGAHAAAALGAARLAAMACGGDEAHWCQP
LPADATFMPQPAQQALLAERYARFVALYPALQSQF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory