SitesBLAST
Comparing Ac3H11_2940 FitnessBrowser__acidovorax_3H11:Ac3H11_2940 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5jo9A Structural characterization of the thermostable bradyrhizobium japonicum d-sorbitol dehydrogenase (see paper)
79% identity, 98% coverage: 6:244/244 of query aligns to 1:239/239 of 5jo9A
4nbuB Crystal structure of fabg from bacillus sp (see paper)
31% identity, 89% coverage: 7:223/244 of query aligns to 5:223/244 of 4nbuB
- active site: G18 (= G20), N111 (= N114), S139 (= S142), Q149 (≠ E152), Y152 (= Y155), K156 (= K159)
- binding acetoacetyl-coenzyme a: D93 (≠ G96), K98 (≠ D101), S139 (= S142), N146 (≠ T149), V147 (≠ P150), Q149 (≠ E152), Y152 (= Y155), F184 (≠ P187), M189 (≠ L192), K200 (≠ E203)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G16), N17 (≠ S19), G18 (= G20), I19 (= I21), D38 (= D40), F39 (≠ R41), V59 (≠ L62), D60 (= D63), V61 (≠ L64), N87 (= N90), A88 (= A91), G89 (= G92), I90 (≠ L93), T137 (= T140), S139 (= S142), Y152 (= Y155), K156 (= K159), P182 (= P185), F184 (≠ P187), T185 (≠ V188), T187 (= T190), M189 (≠ L192)
2japA Clavulanic acid dehydrogenase: structural and biochemical analysis of the final step in the biosynthesis of the beta-lactamase inhibitor clavulanic acid (see paper)
33% identity, 96% coverage: 7:241/244 of query aligns to 3:243/245 of 2japA
- active site: S140 (= S142), Y153 (= Y155), K157 (= K159), A198 (≠ P197)
- binding (2r,3z,5r)-3-(2-hydroxyethylidene)-7-oxo-4-oxa-1-azabicyclo[3.2.0]heptane-2-carboxylic acid: M93 (≠ Y94), S140 (= S142), A142 (= A144), Y153 (= Y155), T185 (≠ P187), Y203 (≠ A202), R206 (≠ K205)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (≠ A18), S15 (= S19), G16 (= G20), I17 (= I21), A36 (≠ D40), R37 (= R41), R38 (≠ D42), L61 (= L62), D62 (= D63), V63 (≠ L64), N89 (= N90), A90 (= A91), G91 (= G92), T112 (≠ L113), M138 (≠ T140), S139 (= S141), S140 (= S142), Y153 (= Y155), K157 (= K159), P183 (= P185), T185 (≠ P187), T186 (≠ V188), T188 (= T190), E189 (≠ S191), L190 (= L192)
2jahC Biochemical and structural analysis of the clavulanic acid dehydeogenase (cad) from streptomyces clavuligerus (see paper)
33% identity, 96% coverage: 7:241/244 of query aligns to 4:244/246 of 2jahC
- active site: S141 (= S142), Y154 (= Y155), K158 (= K159), A199 (≠ P197)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G16), S15 (≠ A18), S16 (= S19), G17 (= G20), I18 (= I21), A37 (≠ D40), R38 (= R41), R39 (≠ D42), D63 (= D63), V64 (≠ L64), N90 (= N90), A91 (= A91), G92 (= G92), T113 (≠ L113), M139 (≠ T140), S141 (= S142), Y154 (= Y155), K158 (= K159), P184 (= P185), G185 (= G186), T186 (≠ P187), T187 (≠ V188), T189 (= T190), E190 (≠ S191), L191 (= L192)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
34% identity, 91% coverage: 6:228/244 of query aligns to 3:223/241 of 5t2uA
- active site: G17 (= G20), T135 (≠ S142), T145 (≠ E152), Y148 (= Y155), K152 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G16), G17 (= G20), R38 (= R41), D39 (= D42), R42 (≠ A45), D60 (= D63), L61 (= L64), N83 (= N90), A84 (= A91), Y87 (= Y94), I133 (≠ T140), T135 (≠ S142), Y148 (= Y155), K152 (= K159), P178 (= P185), P180 (= P187), T181 (≠ V188), T183 (= T190), T185 (≠ L192), T186 (≠ L193)
3p19A Improved NADPH-dependent blue fluorescent protein (see paper)
29% identity, 95% coverage: 10:241/244 of query aligns to 3:236/239 of 3p19A
- active site: S132 (= S142), Y145 (= Y155), K149 (= K159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G16), S11 (≠ A18), S12 (= S19), G13 (= G20), I14 (= I21), A33 (≠ D40), R34 (= R41), R35 (≠ D42), D53 (= D63), V54 (≠ L64), N80 (= N90), A81 (= A91), G82 (= G92), I130 (≠ T140), S132 (= S142), Y145 (= Y155), K149 (= K159), P175 (= P185), A177 (≠ P187), V178 (= V188), T180 (= T190), E181 (≠ S191), L182 (= L192)
A0A1U8QWA2 Glycine betaine reductase ATRR; Nonribosomal peptide synthetase-like protein ATRR; EC 1.2.1.-; EC 1.1.1.- from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see paper)
28% identity, 96% coverage: 7:241/244 of query aligns to 1027:1267/1270 of A0A1U8QWA2
- G1036 (= G16) mutation to A: Compromises binding of the cosubstrate NADPH to aldehyde reductase domain R2. Decreases the aldehyde reductase activity by 4,000-fold; when associated with F-1178.
- Y1178 (= Y155) mutation to F: Does not substantially affect carboxylic acid reductase activity but results to a 150-fold loss of aldehyde reductase activity and the accumulation of glycine betaine aldehyde intermediate. Further decreases the aldehyde reductase activity by 4,000-fold; when associated with F-1178.
Sites not aligning to the query:
- 14:418 Adenylation (A) domain
- 643:937 Carboxylic acid reductase domain R1
- 812 Y→F: Abolishes overall carboxylic acid reductase activity but does nor affect aldehyde reductase activity.
- 1026:1256 Aldehyde reductase domain R2
7qujA Structure of nsneps2, a 7s-cis-trans nepetalactone synthase (see paper)
35% identity, 77% coverage: 5:192/244 of query aligns to 2:197/259 of 7qujA
- binding nicotinamide-adenine-dinucleotide: G13 (= G16), S16 (= S19), G17 (= G20), I18 (= I21), D38 (≠ R41), I39 (≠ D42), Q40 (≠ E43), C61 (≠ L62), D62 (= D63), I63 (≠ L64), N89 (= N90), A90 (= A91), G91 (= G92), T145 (= T140), S146 (= S141), Y160 (= Y155), K164 (= K159), P190 (= P185), M191 (≠ G186), A192 (≠ P187), V193 (= V188), T195 (= T190), L197 (= L192)
Sites not aligning to the query:
6zyzA Structure of the borneol dehydrogenases of salvia rosmarinus with NAD+ (see paper)
28% identity, 90% coverage: 5:223/244 of query aligns to 1:227/259 of 6zyzA
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), S15 (= S19), G16 (= G20), I17 (= I21), D36 (= D40), I37 (≠ R41), Q38 (≠ D42), C58 (≠ L62), D59 (= D63), V60 (≠ L64), N86 (= N90), A87 (= A91), V90 (≠ Y94), I110 (≠ L113), T137 (= T140), Y152 (= Y155), K156 (= K159), V185 (= V188)
- binding (2S)-1-[3-{[(2R)-2-hydroxypropyl]oxy}-2,2-bis({[(2R)-2-hydroxypropyl]oxy}methyl)propoxy]propan-2-ol: P93 (vs. gap), N94 (≠ G97), S95 (≠ D98), D98 (= D101)
8ijgC Crystal structure of alcohol dehydrogenase m5 from burkholderia gladioli with NADP
30% identity, 90% coverage: 4:223/244 of query aligns to 1:228/250 of 8ijgC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G16), T15 (≠ A18), S16 (= S19), I18 (= I21), R38 (= R41), R39 (≠ D42), D60 (= D63), V61 (≠ L64), N87 (= N90), G89 (= G92), R110 (≠ L113), N135 (≠ T140), A137 (≠ S142), Y150 (= Y155), K154 (= K159), P180 (= P185), G181 (= G186), T183 (≠ V188), T185 (= T190), G187 (≠ L192)
3rkrA Crystal structure of a metagenomic short-chain oxidoreductase (sdr) in complex with NADP (see paper)
30% identity, 96% coverage: 6:240/244 of query aligns to 2:219/221 of 3rkrA
- active site: G16 (= G20), S142 (= S142), Y155 (= Y155), K159 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), R15 (≠ S19), A36 (≠ D40), R37 (= R41), D38 (= D42), C61 (≠ L62), D62 (= D63), L63 (= L64), A90 (= A91), G91 (= G92), V92 (≠ L93), G93 (vs. gap)
4esoB Crystal structure of a putative oxidoreductase protein from sinorhizobium meliloti 1021 in complex with NADP
31% identity, 89% coverage: 6:223/244 of query aligns to 2:226/251 of 4esoB
- active site: G16 (= G20), S136 (= S142), M146 (≠ E152), Y149 (= Y155), K153 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), T14 (≠ A18), H15 (≠ S19), M17 (≠ I21), R37 (= R41), N38 (≠ D42), N41 (≠ A45), S58 (≠ L62), D59 (= D63), I60 (≠ L64), N86 (= N90), A87 (= A91), G88 (= G92), T134 (= T140), S136 (= S142), Y149 (= Y155), P179 (= P185), G180 (= G186), I182 (≠ V188), T184 (= T190), T186 (≠ L192), K187 (vs. gap), G188 (vs. gap)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
31% identity, 89% coverage: 7:223/244 of query aligns to 3:222/244 of 7krmC
- active site: G18 (= G20), S140 (= S142), Y155 (= Y155)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), S15 (= S19), G18 (= G20), I19 (= I21), D38 (= D40), L39 (≠ R41), A60 (≠ L62), N61 (≠ D63), V62 (≠ L64), N88 (= N90), V111 (≠ L113), S140 (= S142), Y155 (= Y155), K159 (= K159), I188 (≠ V188), T190 (= T190)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
30% identity, 89% coverage: 6:223/244 of query aligns to 3:227/249 of 4bmsF
- active site: S137 (= S142), H147 (≠ E152), Y150 (= Y155), K154 (= K159), Q195 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G16), N15 (≠ A18), S16 (= S19), I18 (= I21), R38 (= R41), R39 (≠ D42), A59 (≠ L62), D60 (= D63), V61 (≠ L64), N87 (= N90), S88 (≠ A91), G89 (= G92), V110 (≠ L113), S137 (= S142), Y150 (= Y155), K154 (= K159), G181 (= G186), I183 (≠ V188), T185 (= T190), I187 (≠ L192)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
31% identity, 91% coverage: 7:227/244 of query aligns to 3:230/248 of 6ixmC
- active site: G16 (= G20), S142 (= S142), Y155 (= Y155), K159 (= K159)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), S15 (= S19), G16 (= G20), I17 (= I21), D36 (= D40), I37 (≠ R41), A61 (≠ L62), D62 (= D63), T63 (≠ L64), N89 (= N90), A90 (= A91), M140 (≠ T140), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), A186 (≠ G186), Y187 (≠ P187), I188 (≠ V188), L192 (= L192)
P08074 Carbonyl reductase [NADPH] 2; Adipocyte protein P27; AP27; Lung carbonyl reductase; LCR; NADPH-dependent carbonyl reductase 2; EC 1.1.1.184 from Mus musculus (Mouse) (see 2 papers)
30% identity, 90% coverage: 6:225/244 of query aligns to 4:224/244 of P08074
- 11:39 (vs. 13:41, 38% identical) binding
- T38 (≠ D40) mutation to R: Converts the coenzyme specificity from NADP to NAD.
1cydA Carbonyl reductase complexed with NADPH and 2-propanol (see paper)
30% identity, 90% coverage: 6:225/244 of query aligns to 2:222/242 of 1cydA
- active site: G16 (= G20), S134 (= S142), L144 (≠ E152), Y147 (= Y155), K151 (= K159)
- binding isopropyl alcohol: S134 (= S142), Y147 (= Y155), V188 (≠ W196)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), G14 (≠ A18), K15 (≠ S19), I17 (= I21), R37 (= R41), T38 (vs. gap), D58 (= D63), L59 (= L64), N81 (= N90), A83 (≠ G92), V104 (≠ L113), V132 (≠ T140), S134 (= S142), Y147 (= Y155), K151 (= K159), P177 (= P185), T178 (≠ G186), V179 (≠ P187), V180 (= V188), T182 (= T190), M184 (≠ L192), G185 (≠ L193)
4yacA Crystal structure of ligo in complex with nadh from sphingobium sp. Strain syk-6 (see paper)
31% identity, 75% coverage: 5:186/244 of query aligns to 2:188/270 of 4yacA
- active site: S144 (= S142), Y157 (= Y155), K161 (= K159)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G16), S16 (= S19), G17 (= G20), D38 (= D40), I39 (≠ R41), H43 (≠ A45), L63 (= L62), D64 (= D63), L65 (= L64)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
30% identity, 89% coverage: 7:223/244 of query aligns to 4:227/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S142), H147 (≠ E152), Y150 (= Y155), L188 (= L193)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G16), N15 (≠ A18), S16 (= S19), G17 (= G20), I18 (= I21), R38 (= R41), R39 (≠ D42), D60 (= D63), V61 (≠ L64), N87 (= N90), S88 (≠ A91), G89 (= G92), V110 (≠ L113), T135 (= T140), S137 (= S142), Y150 (= Y155), K154 (= K159), P180 (= P185), G181 (= G186), A182 (≠ P187), I183 (≠ V188), T185 (= T190), S187 (≠ L192)
Sites not aligning to the query:
6b9uA Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from brucella melitensis complexed with nadh
29% identity, 95% coverage: 6:237/244 of query aligns to 1:236/244 of 6b9uA
- active site: G15 (= G20), S142 (= S142), L152 (≠ E152), Y155 (= Y155), K159 (= K159)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G16), S14 (= S19), G15 (= G20), F16 (≠ I21), D35 (= D40), R36 (= R41), A57 (≠ L62), D58 (= D63), I59 (≠ L64), N85 (= N90), A86 (= A91), V140 (≠ T140), S142 (= S142), Y155 (= Y155), K159 (= K159), A187 (≠ P187), G188 (≠ V188), T190 (= T190), P191 (≠ S191), L192 (= L192), F196 (≠ W196)
Query Sequence
>Ac3H11_2940 FitnessBrowser__acidovorax_3H11:Ac3H11_2940
MSAARNLQGQVAAITGAASGIGFASAQTMADAGARVVLIDRDEAALAKACATIGPNALPL
VLDLLDARQCASLLQRTLALAGQLDIFHANAGLYVGGDLVDADPDAIDRMLNLNVNVVMK
NVHNVLPHMIERGTGDIIVTSSLAAHFPTPWEPVYASSKWAVNCFVQTVRRQVFKHGIRV
GSISPGPVITSLLADWPAEKLAEAKASGSLIEAAEVAEVVLFMLTRPRGMTIRDVVMMPT
NFDL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory