SitesBLAST
Comparing Ac3H11_2994 FitnessBrowser__acidovorax_3H11:Ac3H11_2994 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P45359 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; CaTHL; EC 2.3.1.9 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
51% identity, 97% coverage: 9:395/397 of query aligns to 4:390/392 of P45359
- V77 (≠ K82) mutation to Q: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Y-153 and K-286.
- C88 (= C93) modified: Disulfide link with 378, In inhibited form
- S96 (≠ M101) binding
- N153 (≠ E158) mutation to Y: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Q-77 and K-286.
- GS 279:280 (≠ AT 284:285) binding
- A286 (≠ E291) mutation to K: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Q-77 and Y-153.
- C378 (= C383) modified: Disulfide link with 88, In inhibited form
- A386 (= A391) binding
4xl4A Crystal structure of thiolase from clostridium acetobutylicum in complex with coa (see paper)
51% identity, 97% coverage: 9:395/397 of query aligns to 4:390/392 of 4xl4A
- active site: C88 (= C93), H348 (= H353), S378 (≠ C383), G380 (= G385)
- binding coenzyme a: L148 (= L153), H156 (≠ S162), R220 (≠ G226), L231 (= L236), A243 (= A248), S247 (= S252), F319 (= F324), H348 (= H353)
6bn2A Crystal structure of acetyl-coa acetyltransferase from elizabethkingia anophelis nuhp1
48% identity, 98% coverage: 9:397/397 of query aligns to 4:392/393 of 6bn2A
5f38D X-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution (see paper)
53% identity, 97% coverage: 10:395/397 of query aligns to 7:393/394 of 5f38D
- active site: C90 (= C93), A348 (= A350), A378 (= A380), L380 (= L382)
- binding [(3~{S})-2,2-dimethyl-3-oxidanyl-4-oxidanylidene-4-[[3-oxidanylidene-3-(2-sulfanylethylamino)propyl]amino]butyl] phosphono hydrogen phosphate: C90 (= C93), L151 (= L153), A246 (= A248), S250 (= S252), I252 (= I254), A321 (= A323), F322 (= F324), H351 (= H353)
5f38B X-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution (see paper)
52% identity, 97% coverage: 10:395/397 of query aligns to 5:389/391 of 5f38B
- active site: C88 (= C93), H347 (= H353), C377 (= C383), G379 (= G385)
- binding coenzyme a: C88 (= C93), L149 (= L153), K219 (vs. gap), F234 (= F240), A242 (= A248), S246 (= S252), A317 (= A323), F318 (= F324), H347 (= H353)
2vu1A Biosynthetic thiolase from z. Ramigera. Complex of with o-pantheteine- 11-pivalate. (see paper)
48% identity, 97% coverage: 9:395/397 of query aligns to 4:389/391 of 2vu1A
1ou6A Biosynthetic thiolase from zoogloea ramigera in complex with acetyl-o- pantetheine-11-pivalate
48% identity, 97% coverage: 9:395/397 of query aligns to 5:390/392 of 1ou6A
- active site: C89 (= C93), H348 (= H353), C378 (= C383), G380 (= G385)
- binding pantothenyl-aminoethanol-acetate pivalic acid: L148 (= L153), H156 (≠ S162), M157 (= M163), F235 (= F240), A243 (= A248), S247 (= S252), A318 (= A323), F319 (= F324), H348 (= H353)
2vu2A Biosynthetic thiolase from z. Ramigera. Complex with s-pantetheine-11- pivalate. (see paper)
48% identity, 97% coverage: 9:395/397 of query aligns to 2:387/389 of 2vu2A
- active site: C86 (= C93), H345 (= H353), C375 (= C383), G377 (= G385)
- binding (3R)-3-hydroxy-2,2-dimethyl-4-oxo-4-({3-oxo-3-[(2-sulfanylethyl)amino]propyl}amino)butyl 2,2-dimethylpropanoate: H153 (≠ S162), M154 (= M163), F232 (= F240), S244 (= S252), G245 (≠ S253), F316 (= F324), H345 (= H353)
1dm3A Acetylated biosynthetic thiolase from zoogloea ramigera in complex with acetyl-coa (see paper)
48% identity, 97% coverage: 9:395/397 of query aligns to 2:387/389 of 1dm3A
- active site: C86 (= C93), H345 (= H353), C375 (= C383), G377 (= G385)
- binding acetyl coenzyme *a: C86 (= C93), L145 (= L153), H153 (≠ S162), M154 (= M163), R217 (≠ G226), S224 (≠ K232), M225 (≠ I233), A240 (= A248), S244 (= S252), M285 (≠ F293), A315 (= A323), F316 (= F324), H345 (= H353), C375 (= C383)
1dlvA Biosynthetic thiolase from zoogloea ramigera in complex with coa (see paper)
48% identity, 97% coverage: 9:395/397 of query aligns to 2:387/389 of 1dlvA
- active site: C86 (= C93), H345 (= H353), C375 (= C383), G377 (= G385)
- binding coenzyme a: C86 (= C93), L145 (= L153), H153 (≠ S162), M154 (= M163), R217 (≠ G226), L228 (= L236), A240 (= A248), S244 (= S252), H345 (= H353)
2wkuA Biosynthetic thiolase from z. Ramigera. The n316h mutant. (see paper)
48% identity, 97% coverage: 9:395/397 of query aligns to 2:387/389 of 2wkuA
- active site: C86 (= C93), H345 (= H353), C375 (= C383), G377 (= G385)
- binding D-mannose: S6 (≠ G13), A7 (= A14), R38 (= R45), K182 (≠ R191), D194 (≠ A203), V280 (≠ Q288), D281 (≠ E289), T287 (= T295), P331 (≠ H339), S332 (≠ D340), V334 (= V342), V336 (= V344), F360 (≠ H368)
P07097 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Shinella zoogloeoides (Crabtreella saccharophila) (see 2 papers)
47% identity, 98% coverage: 8:395/397 of query aligns to 4:390/392 of P07097
- Q64 (= Q68) mutation to A: Slightly lower activity.
- C89 (= C93) mutation to A: Loss of activity.
- C378 (= C383) mutation to G: Loss of activity.
1m1oA Crystal structure of biosynthetic thiolase, c89a mutant, complexed with acetoacetyl-coa (see paper)
48% identity, 97% coverage: 9:395/397 of query aligns to 3:388/390 of 1m1oA
- active site: A87 (≠ C93), H346 (= H353), C376 (= C383), G378 (= G385)
- binding acetoacetyl-coenzyme a: L86 (≠ M92), A87 (≠ C93), L146 (= L153), H154 (≠ S162), M155 (= M163), R218 (≠ G226), S225 (≠ K232), M226 (≠ I233), A241 (= A248), G242 (≠ A249), S245 (= S252), A316 (= A323), F317 (= F324), H346 (= H353), I377 (= I384), G378 (= G385)
P14611 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
48% identity, 97% coverage: 9:395/397 of query aligns to 4:391/393 of P14611
- C88 (= C93) active site, Acyl-thioester intermediate; mutation to S: Almost complete loss of acetoacetyl-CoA thiolase activity.
- H156 (≠ S162) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- F219 (≠ G224) mutation to A: About 50% loss of acetoacetyl-CoA thiolase activity.; mutation to Y: 2-fold increase of acetoacetyl-CoA thiolase activity.
- R221 (≠ G226) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- S248 (= S252) mutation to A: About 40% loss of acetoacetyl-CoA thiolase activity.
- H349 (= H353) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- C379 (= C383) mutation to S: Almost complete loss of acetoacetyl-CoA thiolase activity.
7cw5B Acetyl-coa acetyltransferase from bacillus cereus atcc 14579 (see paper)
47% identity, 97% coverage: 10:396/397 of query aligns to 4:391/394 of 7cw5B
- active site: C87 (= C93), H348 (= H353), C378 (= C383), G380 (= G385)
- binding coenzyme a: L147 (= L153), H155 (≠ S162), M156 (= M163), R220 (≠ G226), T223 (≠ V228), A243 (= A248), P247 (≠ S252), L249 (≠ I254), H348 (= H353)
4o9cC Crystal structure of beta-ketothiolase (phaa) from ralstonia eutropha h16 (see paper)
48% identity, 97% coverage: 9:395/397 of query aligns to 4:391/393 of 4o9cC
- active site: S88 (≠ C93), H349 (= H353), C379 (= C383), G381 (= G385)
- binding coenzyme a: S88 (≠ C93), L148 (= L153), R221 (≠ G226), F236 (= F240), A244 (= A248), S248 (= S252), L250 (≠ I254), A319 (= A323), F320 (= F324), H349 (= H353)
P24752 Acetyl-CoA acetyltransferase, mitochondrial; Acetoacetyl-CoA thiolase; T2; EC 2.3.1.9 from Homo sapiens (Human) (see 6 papers)
48% identity, 97% coverage: 9:395/397 of query aligns to 42:425/427 of P24752
- N93 (= N60) to S: in 3KTD; decreased acetyl-CoA C-acyltransferase activity; less than 10% of the degradative/thiolase activity; dbSNP:rs120074145
- N158 (= N125) to D: in 3KTD; loss of acetyl-CoA C-acyltransferase activity; no degradative/thiolase activity; dbSNP:rs148639841
- G183 (= G152) to R: in 3KTD; no activity; dbSNP:rs120074141
- Y219 (≠ V189) binding ; binding
- RVD 258:260 (≠ KVK 227:229) binding
- K263 (= K232) binding
- A280 (= A248) binding
- A281 (= A249) binding
- A283 (≠ S251) binding
- S284 (= S252) binding
- T297 (≠ R265) to M: in 3KTD; decreased protein abundance; decreased acetyl-CoA C-acyltransferase activity; less than 10% of the degradative/thiolase activity; dbSNP:rs886041122
- A301 (= A269) to P: in 3KTD; loss of acetyl-CoA C-acyltransferase activity; no degradative/thiolase activity; dbSNP:rs1420321267
- I312 (= I280) to T: in 3KTD; decreased protein stability; decreased acetyl-CoA C-acyltransferase activity; less than 10% of the degradative/thiolase activity; dbSNP:rs120074146
- A333 (≠ T301) to P: in 3KTD; loss of protein solubility; loss of acetyl-CoA C-acyltransferase activity; no degradative/thiolase activity; dbSNP:rs120074147
- A380 (= A348) to T: in 3KTD; decreased protein stability; dbSNP:rs120074140
- V381 (≠ C349) binding
Sites not aligning to the query:
- 5 A → P: in dbSNP:rs3741056
2f2sA Human mitochondrial acetoacetyl-coa thiolase
48% identity, 97% coverage: 9:395/397 of query aligns to 11:387/389 of 2f2sA
- active site: C95 (= C93), H347 (= H353), C375 (= C383), G377 (= G385)
- binding coenzyme a: C95 (= C93), L153 (= L153), H161 (≠ S162), M162 (= M163), Y188 (≠ V189), R220 (≠ K227), V221 (= V228), D222 (≠ K229), K225 (= K232), L229 (= L236), F233 (= F240), A242 (= A248), S246 (= S252), A317 (= A323), F318 (= F324), H347 (= H353)
2ib8D Crystallographic and kinetic studies of human mitochondrial acetoacetyl-coa thiolase (t2): the importance of potassium and chloride for its structure and function (see paper)
47% identity, 97% coverage: 9:395/397 of query aligns to 8:391/393 of 2ib8D
Q9BWD1 Acetyl-CoA acetyltransferase, cytosolic; Acetyl-CoA transferase-like protein; Cytosolic acetoacetyl-CoA thiolase; EC 2.3.1.9 from Homo sapiens (Human) (see 2 papers)
46% identity, 98% coverage: 7:395/397 of query aligns to 6:395/397 of Q9BWD1
- K211 (≠ A214) to R: in dbSNP:rs25683
- R223 (≠ G226) binding
- S226 (≠ V228) binding
- S252 (= S252) binding
Query Sequence
>Ac3H11_2994 FitnessBrowser__acidovorax_3H11:Ac3H11_2994
MSTTIQDPIVIVGAARTPMGSLQGDFSSLAAHDLGGAAIKAAIERAGVSPDAVGEVLFGN
CLMAGQGQAPARQAAFKGGLPKGAGAVTLSKMCGSGMKAAMMAHDMLLAGSHDVMVAGGM
ESMTNAPYLLQKGRGGYRLGHDRIFDHMMLDGLEDAYEAGRSMGTFGEDCAAKYSFTREQ
QDAFATASVQRAKAATESGAFAAEIVPVTVKTRAGETVVSVDEGPGKVKLEKIATLKPAF
KKDGTITAASSSSINDGAAALVMMRESTAKKLGAKPLARIVSHATHAQEPEWFATAPLGA
TQKALAKAGWQVGDVQLWEINEAFAVVPMALMKELDLPHDKVNVNGGACALGHPIGASGA
RIMVTLIHALKARGLTKGLATLCIGGGEATAVALELV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory