Comparing Ac3H11_3034 FitnessBrowser__acidovorax_3H11:Ac3H11_3034 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
29% identity, 89% coverage: 25:337/350 of query aligns to 12:312/312 of 4wjmA
7fcaD Pfkb(mycobacterium marinum) (see paper)
29% identity, 87% coverage: 25:328/350 of query aligns to 8:281/282 of 7fcaD
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
26% identity, 74% coverage: 20:279/350 of query aligns to 3:256/306 of 5eynA
Sites not aligning to the query:
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
28% identity, 74% coverage: 20:279/350 of query aligns to 6:259/319 of Q8ZKR2
Sites not aligning to the query:
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
26% identity, 74% coverage: 20:279/350 of query aligns to 7:260/310 of 5yggA
Sites not aligning to the query:
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
28% identity, 74% coverage: 20:279/350 of query aligns to 2:248/299 of 1tz3A
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
28% identity, 74% coverage: 20:279/350 of query aligns to 2:248/297 of 1tz6A
Sites not aligning to the query:
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
30% identity, 77% coverage: 25:295/350 of query aligns to 9:273/322 of 3lkiB
Sites not aligning to the query:
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
24% identity, 74% coverage: 21:280/350 of query aligns to 3:254/304 of 3ih0A
Sites not aligning to the query:
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
24% identity, 74% coverage: 21:280/350 of query aligns to 2:253/302 of 3gbuA
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
27% identity, 75% coverage: 19:279/350 of query aligns to 2:258/300 of 1v1bA
Sites not aligning to the query:
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
27% identity, 75% coverage: 19:279/350 of query aligns to 2:258/301 of 1v1aA
Sites not aligning to the query:
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
27% identity, 75% coverage: 19:279/350 of query aligns to 2:258/309 of Q53W83
Sites not aligning to the query:
>Ac3H11_3034 FitnessBrowser__acidovorax_3H11:Ac3H11_3034
MVFPIQTADSIPANTAPPLRVATAGEALFDLIEEPDGRLQPCAGGAVYNLTRALGLQGVG
TLYLNPLSGDLLGRQLARGLHDAGVALAAPTPVRAPSALALAALDAEGKASYSFYRDGVA
DRQVTAAALTAACSALPELQVVATGCLALVAQDAALYLPWLAAQRAAGRMVVVDANLRLS
AVDDADAYRANVMAALQHAHLIKVSDDDLEALAIPGANALERAHFLQQQTQAQWLALTLG
PNGAWLLQRDGLAVHAREEAPITVVDTVGAGDCFLAGLITAWLAGPERGEDALALRAGGL
TAPVTEARLRAVLHHALASASHCVERAGCTPPRYEEVRERLSLRRAATTR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory