Comparing Ac3H11_3035 FitnessBrowser__acidovorax_3H11:Ac3H11_3035 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
33% identity, 84% coverage: 32:313/337 of query aligns to 3:268/274 of 2ioyA
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
33% identity, 84% coverage: 32:313/337 of query aligns to 4:268/271 of 1dbpA
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
33% identity, 84% coverage: 32:313/337 of query aligns to 11:274/284 of 7e7mC
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
31% identity, 77% coverage: 29:289/337 of query aligns to 2:245/270 of 4zjpA
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
30% identity, 77% coverage: 29:289/337 of query aligns to 2:256/287 of 5dteB
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
29% identity, 79% coverage: 32:297/337 of query aligns to 5:265/297 of 4ry9B
4ry9A Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
29% identity, 79% coverage: 32:297/337 of query aligns to 5:265/297 of 4ry9A
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
29% identity, 80% coverage: 34:302/337 of query aligns to 6:270/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
29% identity, 80% coverage: 34:302/337 of query aligns to 6:270/288 of 1gudA
Sites not aligning to the query:
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
29% identity, 80% coverage: 34:302/337 of query aligns to 6:270/288 of 8wlbA
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
29% identity, 80% coverage: 34:302/337 of query aligns to 6:270/288 of 8wl9A
3ksmA Crystal structure of abc-type sugar transport system, periplasmic component from hahella chejuensis
26% identity, 84% coverage: 30:313/337 of query aligns to 1:274/276 of 3ksmA
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
30% identity, 91% coverage: 32:336/337 of query aligns to 4:307/313 of 2h3hA
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
32% identity, 84% coverage: 32:313/337 of query aligns to 4:284/305 of 3c6qC
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
26% identity, 84% coverage: 32:313/337 of query aligns to 4:278/292 of 2fn8A
2x7xA Fructose binding periplasmic domain of hybrid two component system bt1754 (see paper)
28% identity, 61% coverage: 72:276/337 of query aligns to 42:237/301 of 2x7xA
Sites not aligning to the query:
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
28% identity, 88% coverage: 32:326/337 of query aligns to 3:288/290 of 4wutA
5dkvA Crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d- tagatopyranose
25% identity, 84% coverage: 32:313/337 of query aligns to 9:286/303 of 5dkvA
4rxtA Crystal structure of carbohydrate transporter solute binding protein arad_9553 from agrobacterium radiobacter, target efi-511541, in complex with d-arabinose
26% identity, 87% coverage: 28:319/337 of query aligns to 3:286/295 of 4rxtA
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
28% identity, 80% coverage: 31:298/337 of query aligns to 4:257/287 of 5ibqA
>Ac3H11_3035 FitnessBrowser__acidovorax_3H11:Ac3H11_3035
MQRTPAFALSALALTGALACGLAQAQTSEPVIGLITKTETNPFFVKMKEGATAEAKKLGA
KLVSAAGKTDGDNAGQVTAMENLIAAGAKTILITPSDAKAIVPAIKKAQAKGVMVIALDS
PTEPMDATDALFATDNYKAGELIGQYAKAAAAGKKPVIATLDLFPGHPVGAQRHNGFLKG
FGLQANDAKSNELSRPAEVVCMADSFGDRAKGQTGMENCLQKNPDINIVYTINEPAAAGA
YNALKAAGKEKNVLIVSVDGGCAGIADVGKGVIAATSQQYPLRMAAMGVAAGVEYAKTGK
KVSGYTDTGVTLIAAKPMAGVDSKDVKTGTDLCWGAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory