Comparing Ac3H11_3037 FitnessBrowser__acidovorax_3H11:Ac3H11_3037 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
35% identity, 94% coverage: 13:263/268 of query aligns to 4:247/501 of P04983
3c4jA Abc protein artp in complex with atp-gamma-s
31% identity, 78% coverage: 19:227/268 of query aligns to 9:208/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
31% identity, 78% coverage: 19:227/268 of query aligns to 9:208/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
31% identity, 78% coverage: 19:227/268 of query aligns to 9:208/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
31% identity, 78% coverage: 19:227/268 of query aligns to 9:208/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 77% coverage: 21:227/268 of query aligns to 9:206/240 of 4ymuJ
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
30% identity, 95% coverage: 13:266/268 of query aligns to 2:248/253 of 6z5uK
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
30% identity, 95% coverage: 13:266/268 of query aligns to 4:250/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
30% identity, 95% coverage: 13:266/268 of query aligns to 4:250/263 of 7d08B
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 80% coverage: 13:227/268 of query aligns to 2:206/241 of 4u00A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 84% coverage: 13:237/268 of query aligns to 4:230/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 84% coverage: 13:237/268 of query aligns to 4:230/253 of 1g9xB
3d31A Modbc from methanosarcina acetivorans (see paper)
31% identity, 84% coverage: 20:244/268 of query aligns to 7:215/348 of 3d31A
Sites not aligning to the query:
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
29% identity, 83% coverage: 12:234/268 of query aligns to 5:216/240 of 1ji0A
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
28% identity, 84% coverage: 20:244/268 of query aligns to 12:228/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
28% identity, 84% coverage: 20:244/268 of query aligns to 12:228/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
28% identity, 84% coverage: 20:244/268 of query aligns to 12:228/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
28% identity, 84% coverage: 20:244/268 of query aligns to 12:228/353 of Q97UY8
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
29% identity, 83% coverage: 13:235/268 of query aligns to 1:214/232 of 1f3oA
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
32% identity, 85% coverage: 27:255/268 of query aligns to 25:246/265 of P07821
>Ac3H11_3037 FitnessBrowser__acidovorax_3H11:Ac3H11_3037
MTTSTQTTNVPLVMQAKGLVKRYGQVTALDGADFELRAGEILAVIGDNGAGKSSLIKALS
GATVPDEGEILLDGQRIQFKSPIEARRAGIETVYQDLAVAPAMTIAENLFLGRELRRPGL
LGTALRMLDKKKMLEESVARMAELKVGIRSMTQAVETLSGGQRQCVAVARAAAFARHVVI
MDEPTAALGVKEGNMVLELIRRVRDKGLPVILISHNMPHVFEIADRIHIARLGKRAAVVN
PKKISMSDTVAVMTGAMAASDLPAECLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory