SitesBLAST
Comparing Ac3H11_3072 FitnessBrowser__acidovorax_3H11:Ac3H11_3072 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4amvA E.Coli glucosamine-6p synthase in complex with fructose-6p (see paper)
51% identity, 100% coverage: 2:641/641 of query aligns to 1:608/608 of 4amvA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W85), N98 (= N121), G99 (= G122), Y248 (= Y274), E481 (= E514), K485 (= K518), E488 (= E521), H504 (= H537), K603 (= K636)
- binding fructose -6-phosphate: G301 (= G333), T302 (= T334), S303 (= S335), S347 (≠ T379), Q348 (= Q380), S349 (= S381), T352 (= T384), S401 (= S433), K485 (= K518), E488 (= E521)
1jxaA Glucosamine 6-phosphate synthase with glucose 6-phosphate (see paper)
51% identity, 100% coverage: 2:641/641 of query aligns to 1:608/608 of 1jxaA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W85), N98 (= N121), G99 (= G122), Y248 (= Y274), E481 (= E514), K485 (= K518), E488 (= E521), H504 (= H537), K603 (= K636)
- binding glucose-6-phosphate: T302 (= T334), S303 (= S335), S347 (≠ T379), Q348 (= Q380), S349 (= S381), T352 (= T384), S401 (= S433), K485 (= K518), E488 (= E521)
2j6hA E. Coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine (see paper)
51% identity, 100% coverage: 2:641/641 of query aligns to 1:608/608 of 2j6hA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W85), N98 (= N121), G99 (= G122), Y248 (= Y274), E481 (= E514), K485 (= K518), E488 (= E521), H504 (= H537), K603 (= K636)
- binding glucose-6-phosphate: T302 (= T334), S347 (≠ T379), Q348 (= Q380), S349 (= S381), T352 (= T384), V399 (= V431), S401 (= S433), E488 (= E521)
- binding 5-oxo-l-norleucine: C1 (= C2), R73 (= R84), W74 (= W85), T76 (= T87), H86 (= H97), N98 (= N121), G99 (= G122), D123 (= D146)
1mosA Isomerase domain of glucosamine 6-phosphate synthase complexed with 2- amino-2-deoxyglucitol 6-phosphate (see paper)
55% identity, 58% coverage: 268:641/641 of query aligns to 1:367/367 of 1mosA
- active site: E240 (= E514), K244 (= K518), E247 (= E521), H263 (= H537), K362 (= K636)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T61 (= T334), S62 (= S335), S106 (≠ T379), Q107 (= Q380), S108 (= S381), T111 (= T384), K244 (= K518), E247 (= E521)
1morA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate (see paper)
56% identity, 58% coverage: 272:641/641 of query aligns to 4:366/366 of 1morA
- active site: E239 (= E514), K243 (= K518), E246 (= E521), H262 (= H537), K361 (= K636)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T334), S105 (≠ T379), Q106 (= Q380), S107 (= S381), T110 (= T384), V157 (= V431), A360 (= A635), K361 (= K636)
1moqA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate (see paper)
56% identity, 58% coverage: 272:641/641 of query aligns to 4:366/366 of 1moqA
- active site: E239 (= E514), K243 (= K518), E246 (= E521), H262 (= H537), K361 (= K636)
- binding 2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: T60 (= T334), S61 (= S335), S105 (≠ T379), Q106 (= Q380), S107 (= S381), T110 (= T384), V157 (= V431), A360 (= A635), K361 (= K636)
6svmA Crystal structure of human gfat-1 in complex with glucose-6-phosphate, l-glu, and udp-galnac (see paper)
35% identity, 100% coverage: 2:641/641 of query aligns to 1:660/660 of 6svmA
- active site: L7 (≠ V8), R32 (= R27), W95 (= W85), N122 (= N121), G123 (= G122), E533 (= E514), K537 (= K518), E540 (= E521), H556 (= H537), K655 (= K636)
- binding glucose-6-phosphate: C353 (= C332), T355 (= T334), S356 (= S335), S400 (≠ T379), Q401 (= Q380), S402 (= S381), T405 (= T384), S453 (= S433), K537 (= K518), E540 (= E521)
- binding glutamic acid: C1 (= C2), R94 (= R84), W95 (= W85), T97 (= T87), H107 (= H97), G123 (= G122), D147 (= D146)
- binding magnesium ion: S434 (≠ V414), R435 (= R415), T437 (≠ C417)
- binding uridine-diphosphate-n-acetylgalactosamine: Q289 (= Q263), R322 (≠ V296), G334 (≠ P313), G424 (≠ T404), T426 (≠ C406), S434 (≠ V414), T437 (≠ C417), C439 (≠ L419), G440 (≠ A420), V441 (≠ Y421), H442 (≠ I422)
6r4eA Crystal structure of human gfat-1 in complex with glucose-6-phosphate and l-glu (see paper)
36% identity, 100% coverage: 2:641/641 of query aligns to 1:663/663 of 6r4eA
- active site: L7 (≠ V8), R32 (= R27), W95 (= W85), N122 (= N121), G123 (= G122), E536 (= E514), K540 (= K518), E543 (= E521), H559 (= H537), K658 (= K636)
- binding glucose-6-phosphate: T358 (= T334), S359 (= S335), S403 (≠ T379), Q404 (= Q380), S405 (= S381), T408 (= T384), S456 (= S433), K540 (= K518), E543 (= E521)
- binding glutamic acid: C1 (= C2), R94 (= R84), W95 (= W85), T97 (= T87), G123 (= G122), D147 (= D146)
7dnrA Crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. Coli
54% identity, 56% coverage: 272:632/641 of query aligns to 4:357/357 of 7dnrA
6r4gA Crystal structure of human gfat-1 in complex with udp-glcnac (see paper)
35% identity, 99% coverage: 2:634/641 of query aligns to 1:652/652 of 6r4gA
- active site: L7 (≠ V8), R32 (= R27), W95 (= W85), N122 (= N121), G123 (= G122), E532 (= E514), K536 (= K518), E539 (= E521), H555 (= H537)
- binding glucose-6-phosphate: G353 (= G333), T354 (= T334), S355 (= S335), S399 (≠ T379), Q400 (= Q380), S401 (= S381), T404 (= T384), S452 (= S433), E539 (= E521)
- binding magnesium ion: S433 (≠ V414), R434 (= R415), T436 (≠ C417)
- binding uridine-diphosphate-n-acetylglucosamine: Q288 (= Q263), R321 (≠ V296), G333 (≠ P313), G423 (≠ T404), T425 (≠ C406), S433 (≠ V414), T436 (≠ C417), C438 (≠ L419), G439 (≠ A420), V440 (≠ Y421), H441 (≠ I422)
Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; D-fructose-6-phosphate amidotransferase 1; Glutamine:fructose-6-phosphate amidotransferase 1; GFAT 1; GFAT1; Hexosephosphate aminotransferase 1; EC 2.6.1.16 from Homo sapiens (Human) (see paper)
36% identity, 69% coverage: 197:641/641 of query aligns to 262:699/699 of Q06210
P14742 Glutamine--fructose-6-phosphate aminotransferase [isomerizing]; GFAT; D-fructose-6-phosphate amidotransferase; Hexosephosphate aminotransferase; EC 2.6.1.16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
36% identity, 68% coverage: 209:641/641 of query aligns to 287:717/717 of P14742
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 active site, For GATase activity
2zj4A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
39% identity, 58% coverage: 272:641/641 of query aligns to 3:365/365 of 2zj4A
- active site: E238 (= E514), K242 (= K518), E245 (= E521), H261 (= H537), K360 (= K636)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T60 (= T334), S61 (= S335), S105 (≠ T379), Q106 (= Q380), S107 (= S381), T110 (= T384), V156 (= V431), A157 (= A432), K242 (= K518), E245 (= E521)
2zj3A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
39% identity, 58% coverage: 272:641/641 of query aligns to 3:365/365 of 2zj3A
- active site: E238 (= E514), K242 (= K518), E245 (= E521), H261 (= H537), K360 (= K636)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T334), S61 (= S335), S105 (≠ T379), Q106 (= Q380), S107 (= S381), T110 (= T384), V156 (= V431), A359 (= A635), K360 (= K636)
2v4mA The isomerase domain of human glutamine-fructose-6-phosphate transaminase 1 (gfpt1) in complex with fructose 6-phosphate
37% identity, 56% coverage: 272:629/641 of query aligns to 2:352/352 of 2v4mA
- active site: E237 (= E514), K241 (= K518), E244 (= E521), H260 (= H537)
- binding fructose -6-phosphate: T59 (= T334), S60 (= S335), S104 (≠ T379), Q105 (= Q380), S106 (= S381), T109 (= T384), A156 (= A432), S157 (= S433), K241 (= K518), E244 (= E521)
2pocB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
39% identity, 56% coverage: 273:629/641 of query aligns to 1:352/352 of 2pocB
- active site: E236 (= E514), K240 (= K518), E243 (= E521), H259 (= H537)
- binding 6-O-phosphono-beta-D-glucopyranose: C55 (= C332), T57 (= T334), S58 (= S335), S102 (≠ T379), Q103 (= Q380), S104 (= S381), T107 (= T384), E243 (= E521)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (vs. gap), G36 (= G314), G126 (≠ T404), V128 (≠ C406), S136 (≠ V414), T139 (≠ C417), C141 (≠ L419), G142 (≠ A420), V143 (≠ Y421), H144 (≠ I422)
1xfgA Glutaminase domain of glucosamine 6-phosphate synthase complexed with l-glu hydroxamate (see paper)
47% identity, 39% coverage: 2:253/641 of query aligns to 1:230/238 of 1xfgA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W85), N98 (= N121), G99 (= G122)
- binding glutamine hydroxamate: C1 (= C2), R73 (= R84), W74 (= W85), T76 (= T87), H86 (= H97), N98 (= N121), G99 (= G122), D123 (= D146)
1xffA Glutaminase domain of glucosamine 6-phosphate synthase complexed with glutamate (see paper)
47% identity, 39% coverage: 2:253/641 of query aligns to 1:230/238 of 1xffA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W85), N98 (= N121), G99 (= G122)
- binding glutamic acid: C1 (= C2), R73 (= R84), W74 (= W85), T76 (= T87), H86 (= H97), N98 (= N121), G99 (= G122), D123 (= D146)
2putA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
37% identity, 56% coverage: 273:629/641 of query aligns to 1:339/339 of 2putA
- active site: E236 (= E514), K240 (= K518), E243 (= E521)
- binding fructose -6-phosphate: C55 (= C332), T57 (= T334), S102 (≠ T379), Q103 (= Q380), S104 (= S381), T107 (= T384), A154 (= A432), S155 (= S433), K240 (= K518)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (vs. gap), G36 (= G314), G126 (≠ T404), V128 (≠ C406), S136 (≠ V414), T139 (≠ C417), C141 (≠ L419), G142 (≠ A420), V143 (≠ Y421), H144 (≠ I422)
2puwB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
37% identity, 56% coverage: 273:629/641 of query aligns to 1:331/331 of 2puwB
Query Sequence
>Ac3H11_3072 FitnessBrowser__acidovorax_3H11:Ac3H11_3072
MCGIVGAVSTRNIVPILVQGLQRLEYRGYDSCGVAVHGASIDASRHGTARGGLQRARSTA
RVAELLEQVQAEHVDGATGIAHTRWATHGAPAVHNAHPHFSHGLGVDAATQQAGRVALVH
NGIIENHEELRRTLQARGYVFASQTDTEVIAHLVDSHYSGDLFEAVRATVAELHGAYAIA
VIHKDEPHRVVGARAGSPLILGVGNAGAEHFLASDAMALAGVTDQIVYLEEGDLVDLQLG
RYWIVGKDGAALSPAQRPVRTVQAHSGAAELGPYRHYMQKEIFEQPRAIADTLEGVEGIV
PELFDGAGQHGQPGAAAWRVFKEIDNVLILACGTSYYSGCAAKYWLEEIAGIPTQVEVAS
EYRYRTSVPNPRTLVVTITQSGETADTLAALRHAQSLGMQHTLTICNVVTSAMVRECKLA
YITRAGVEIGVASTKAFTTQLAGLFLLTLALAQSKGRLSEEQEAAHLKAMRHLPVALQAV
LALEPQLISWAEDFARMENALFLGRGLHYPIALEGALKLKEISYIHAEAYPAGELKHGPL
ALVTSAMPVVTVAPNDALLEKLKSNMQEVRARAGVLYVLADGDTHIESSEGIHVIRMPEH
YGALSPLLHVVPLQLLAYHTACARGTDVDKPRNLAKSVTVE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory