Comparing Ac3H11_3085 FitnessBrowser__acidovorax_3H11:Ac3H11_3085 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
33% identity, 31% coverage: 51:222/556 of query aligns to 60:224/763 of P40939
Sites not aligning to the query:
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
32% identity, 34% coverage: 51:241/556 of query aligns to 24:203/259 of 5zaiC
Sites not aligning to the query:
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
33% identity, 30% coverage: 51:219/556 of query aligns to 24:185/707 of 6yswA
Sites not aligning to the query:
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
31% identity, 32% coverage: 62:241/556 of query aligns to 36:205/261 of 5jbxB
Sites not aligning to the query:
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
32% identity, 30% coverage: 52:220/556 of query aligns to 28:183/260 of 2hw5C
Sites not aligning to the query:
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
30% identity, 30% coverage: 52:219/556 of query aligns to 27:176/254 of 2dubA
Sites not aligning to the query:
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
30% identity, 30% coverage: 52:219/556 of query aligns to 28:180/258 of 1mj3A
Sites not aligning to the query:
Q4WF54 Mevalonyl-coenzyme A hydratase sidH; Siderophore biosynthesis protein H; EC 4.2.1.- from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
29% identity, 30% coverage: 74:241/556 of query aligns to 53:210/270 of Q4WF54
Sites not aligning to the query:
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
30% identity, 30% coverage: 52:219/556 of query aligns to 58:212/290 of P14604
Sites not aligning to the query:
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
30% identity, 30% coverage: 52:219/556 of query aligns to 28:182/260 of 1dubA
Sites not aligning to the query:
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
30% identity, 30% coverage: 52:219/556 of query aligns to 26:180/258 of 1ey3A
Sites not aligning to the query:
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
33% identity, 19% coverage: 63:169/556 of query aligns to 47:151/729 of 8pf8A
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
33% identity, 19% coverage: 63:169/556 of query aligns to 48:152/730 of 8oquA
Sites not aligning to the query:
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
33% identity, 19% coverage: 63:169/556 of query aligns to 47:151/729 of 8oqtA
Sites not aligning to the query:
8oqnA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-53
33% identity, 19% coverage: 63:169/556 of query aligns to 47:151/729 of 8oqnA
Sites not aligning to the query:
8opvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with resveratrol (fragment-b-h11)
33% identity, 19% coverage: 63:169/556 of query aligns to 47:151/729 of 8opvA
Sites not aligning to the query:
8opuA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
33% identity, 19% coverage: 63:169/556 of query aligns to 47:151/729 of 8opuA
Sites not aligning to the query:
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80
33% identity, 19% coverage: 63:169/556 of query aligns to 47:151/728 of 8oqrA
Sites not aligning to the query:
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
33% identity, 19% coverage: 63:169/556 of query aligns to 49:153/731 of 4b3iA
Sites not aligning to the query:
4omrA Crystal structure of tfu_1878, a putative enoyl-coa hydratase from thermobifida fusca yx in complex with acetoacetyl-coa
25% identity, 37% coverage: 25:230/556 of query aligns to 15:208/255 of 4omrA
Sites not aligning to the query:
>Ac3H11_3085 FitnessBrowser__acidovorax_3H11:Ac3H11_3085
MTHPVQPPSRVDYRTDPTQYRHWKLAVDGAVARLSLDIAEDGGIRPGYKLKLNSYDLGVD
IELHDALNRIRFEHPQVRSVIVTSARDRIFCSGANIFMLGVSSHAWKVNFCKFTNETRNG
IEDSSKHSGLKFVAAVNGACAGGGYELALACDEIVLVDDRSSAVSLPEVPLLGVLPGTGG
LTRVTDKRHVRHDLADIFCTSVEGVRGQRAVDWRLVDRIAKPAQFAAAVDDTAARLTEGS
PRPSHAQGVALPRVEREETADSLRYTHVSVSIDRTRRTATLTLKAPTGPQPTDIADIEAA
GAAWWPLALARQLDDAILNLRTNELDIGTWLLKTEGDAQAVLASDATLIAHQGHWLVRET
IGALRRTFARLDVSSRSLFALVEPGSAFAGSLAELSFAADRTYMLALPDDTERAPKITLN
EFNFGLLPMVNDQSRLQRRFYEEAAPLEAARAAAGKPQDADAALALGLVTAAPDDIDWDD
EIRIAIEERAAMSPDSLTGLEANLRFASKENMNTRIFGRLTAWQNWIFNRPNAVGDKGAL
KVYGTGQKAGFDLNRV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory