SitesBLAST
Comparing Ac3H11_3089 FitnessBrowser__acidovorax_3H11:Ac3H11_3089 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vroA Crystal structure of aldehyde dehydrogenase from burkholderia xenovorans lb400 (see paper)
64% identity, 96% coverage: 1:501/520 of query aligns to 2:508/521 of 2vroA
- active site: N160 (= N159), K183 (= K182), E258 (= E257), C297 (= C296), E401 (= E400), L496 (= L489)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I156 (= I155), K183 (= K182), S217 (= S216), S235 (= S234), T238 (= T237), L242 (≠ I241), F403 (= F402)
2y53A Crystal structure of e257q mutant of the box pathway encoded aldh from burkholderia xenovorans lb400 (see paper)
64% identity, 96% coverage: 1:501/520 of query aligns to 2:507/529 of 2y53A
- active site: N160 (= N159), K183 (= K182), Q258 (≠ E257), C297 (= C296), E401 (= E400), L495 (= L489)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I156 (= I155), N157 (= N156), F159 (= F158), N160 (= N159), K183 (= K182), A185 (= A184), T186 (= T185), S217 (= S216), F232 (= F231), G234 (= G233), S235 (= S234), A236 (= A235), T238 (= T237), A259 (= A258), D260 (= D259), C297 (= C296), F403 (= F402)
P77455 Bifunctional protein PaaZ; EC 3.3.2.12; EC 1.2.1.91 from Escherichia coli (strain K12) (see paper)
45% identity, 98% coverage: 5:514/520 of query aligns to 4:509/681 of P77455
- E256 (= E257) mutation to Q: Catalyzes the formation of 3-oxo-5,6-dehydrosuberyl-CoA semialdehyde instead of 3-oxo-5,6-dehydrosuberyl-CoA.
6jqoA Structure of paaz, a bifunctional enzyme in complex with NADP+ and ccoa (see paper)
45% identity, 98% coverage: 5:514/520 of query aligns to 3:508/678 of 6jqoA
- active site: N157 (= N159), E255 (= E257), C294 (= C296), L483 (= L489)
- binding crotonyl coenzyme a: V97 (= V100), F107 (≠ G110), S111 (≠ R114), F158 (= F160), W161 (= W163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: N154 (= N156), F156 (= F158), N157 (= N159), T183 (= T185), T230 (= T232), G231 (= G233), S232 (= S234), T235 (= T237), A256 (= A258), D257 (= D259), C294 (= C296)
Sites not aligning to the query:
6jqnA Structure of paaz, a bifunctional enzyme in complex with NADP+ and ocoa (see paper)
45% identity, 98% coverage: 5:514/520 of query aligns to 3:508/678 of 6jqnA
- active site: N157 (= N159), E255 (= E257), C294 (= C296), L483 (= L489)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R19 (≠ T21), I153 (= I155), N154 (= N156), A155 (= A157), F156 (= F158), K180 (= K182), A182 (= A184), T183 (= T185), T230 (= T232), G231 (= G233), S232 (= S234), T235 (= T237), L239 (≠ I241), E255 (= E257), A256 (= A258), D257 (= D259), C294 (= C296), F396 (= F402), H471 (= H477)
Sites not aligning to the query:
6jqmA Structure of paaz with NADPH (see paper)
45% identity, 98% coverage: 5:514/520 of query aligns to 3:508/678 of 6jqmA
- active site: N157 (= N159), E255 (= E257), C294 (= C296), L483 (= L489)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R19 (≠ T21), I153 (= I155), N154 (= N156), A155 (= A157), F156 (= F158), N157 (= N159), K180 (= K182), A182 (= A184), T183 (= T185), G231 (= G233), S232 (= S234), T235 (= T237), A256 (= A258), D257 (= D259), C294 (= C296), E394 (= E400), F396 (= F402)
3ty7B Crystal structure of aldehyde dehydrogenase family protein from staphylococcus aureus
25% identity, 76% coverage: 57:449/520 of query aligns to 59:429/454 of 3ty7B
Sites not aligning to the query:
5izdA Wild-type glyceraldehyde dehydrogenase from thermoplasma acidophilum in complex with NADP
23% identity, 94% coverage: 8:495/520 of query aligns to 6:473/494 of 5izdA
- active site: N149 (= N159), K172 (= K182), E247 (≠ L266), C281 (= C296), E381 (= E400), E458 (≠ P480)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L145 (≠ I155), T146 (≠ N156), W148 (≠ F158), K172 (= K182), P173 (= P183), S174 (≠ A184), S175 (≠ T185), R204 (≠ S215), G205 (≠ S216), G209 (≠ M220), D210 (= D221), G225 (= G233), S226 (= S234), T229 (= T237)
3jz4A Crystal structure of e. Coli NADP dependent enzyme (see paper)
27% identity, 82% coverage: 11:436/520 of query aligns to 16:421/481 of 3jz4A
- active site: N156 (= N159), K179 (= K182), E254 (≠ L266), C288 (= C296), E385 (= E400)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: P154 (≠ A157), W155 (≠ F158), K179 (= K182), A181 (= A184), S182 (≠ T185), A212 (≠ S216), G216 (≠ M220), G232 (= G233), S233 (= S234), I236 (≠ T237), C288 (= C296), K338 (≠ S346), E385 (= E400), F387 (= F402)
Sites not aligning to the query:
P25526 Succinate-semialdehyde dehydrogenase [NADP(+)] GabD; SSDH; Glutarate-semialdehyde dehydrogenase; EC 1.2.1.79; EC 1.2.1.- from Escherichia coli (strain K12) (see paper)
27% identity, 82% coverage: 11:436/520 of query aligns to 17:422/482 of P25526
4neaA 1.90 angstrom resolution crystal structure of betaine aldehyde dehydrogenase (betb) from staphylococcus aureus in complex with NAD+ and bme-free cys289 (see paper)
26% identity, 72% coverage: 61:436/520 of query aligns to 77:435/505 of 4neaA
- active site: N166 (= N159), K189 (= K182), E264 (≠ L266), C298 (= C296), E399 (= E400)
- binding nicotinamide-adenine-dinucleotide: P164 (≠ A157), K189 (= K182), E192 (≠ T185), G222 (= G214), G226 (= G218), G242 (= G233), G243 (≠ S234), T246 (= T237), H249 (≠ V240), I250 (= I241), C298 (= C296), E399 (= E400), F401 (= F402)
Sites not aligning to the query:
1bpwA Betaine aldehyde dehydrogenase from cod liver (see paper)
25% identity, 85% coverage: 64:504/520 of query aligns to 81:492/503 of 1bpwA
- active site: N166 (= N159), K189 (= K182), E263 (≠ N255), C297 (= C296), E400 (= E400), E477 (≠ A483)
- binding nicotinamide-adenine-dinucleotide: I162 (= I155), L163 (≠ N156), W165 (≠ F158), N166 (= N159), K189 (= K182), G221 (vs. gap), G225 (≠ A217), T240 (= T232), G241 (= G233), S242 (= S234), T245 (= T237), E263 (≠ N255), L264 (≠ I256), C297 (= C296), E400 (= E400), F402 (= F402), F466 (≠ H468)
P56533 4-trimethylaminobutyraldehyde dehydrogenase; TMABA-DH; TMABADH; Aldehyde dehydrogenase family 9 member A1; Betaine aldehyde dehydrogenase; BADH; EC 1.2.1.47; EC 1.2.1.3 from Gadus morhua subsp. callarias (Baltic cod) (Gadus callarias) (see paper)
25% identity, 85% coverage: 64:504/520 of query aligns to 81:492/503 of P56533
P17202 Aminoaldehyde dehydrogenase BADH; 4-trimethylammoniobutyraldehyde dehydrogenase BADH; Aminobutyraldehyde dehydrogenase BADH; Betaine aldehyde dehydrogenase; SoBADH; EC 1.2.1.-; EC 1.2.1.47; EC 1.2.1.19; EC 1.2.1.8 from Spinacia oleracea (Spinach) (see 3 papers)
24% identity, 85% coverage: 65:505/520 of query aligns to 71:484/497 of P17202
- D96 (≠ N90) binding
- SPW 156:158 (≠ NAF 156:158) binding
- Y160 (≠ F160) mutation to A: Decreases binding affinity for betaine aldehyde; increases binding affinity for 4-(trimethylamino)butanal.
- W167 (≠ E167) mutation to A: Decreases binding affinity for betaine aldehyde; increases binding affinity for 4-aminobutanal.
- KPSE 182:185 (≠ KPAT 182:185) binding
- L186 (≠ A186) binding
- SSAT 236:239 (≠ SAET 234:237) binding
- V251 (≠ Q249) binding in other chain
- L258 (= L267) binding
- W285 (vs. gap) mutation to A: Decreases binding affinity for betaine aldehyde.
- E390 (= E400) binding
- A441 (≠ H451) mutation to I: Decreases binding affinity for betaine aldehyde; increases binding affinity for 4-aminobutanal.
- C450 (≠ D460) mutation to S: Loss of partial inactivation by betaine aldehyde in the absence of NAD(+).
- W456 (≠ H477) binding ; mutation to A: Decreases binding affinity for betaine aldehyde.
- K460 (≠ G481) binding
Sites not aligning to the query:
6wsbA Crystal structure of a betaine aldehyde dehydrogenase from burkholderia pseudomallei bound to cofactor NAD (see paper)
28% identity, 77% coverage: 24:422/520 of query aligns to 26:407/489 of 6wsbA
- active site: N152 (= N159), E250 (vs. gap), C284 (= C296)
- binding nicotinamide-adenine-dinucleotide: I148 (= I155), G149 (≠ N156), A150 (= A157), W151 (≠ F158), N152 (= N159), K175 (= K182), E178 (≠ T185), G208 (vs. gap), G211 (= G218), A212 (≠ L219), F225 (= F231), T226 (= T232), G227 (= G233), G228 (≠ S234), T231 (= T237), V235 (≠ I241), E250 (vs. gap), L251 (= L267), G252 (≠ P268), C284 (= C296), E385 (= E400), F387 (= F402)
Sites not aligning to the query:
7uyyA The crystal structure of the pseudomonas aeruginosa aldehyde dehydrogenase encoded by the pa4189 gene in complex with nadh (see paper)
30% identity, 55% coverage: 150:433/520 of query aligns to 160:431/496 of 7uyyA
- binding 1,4-dihydronicotinamide adenine dinucleotide: V165 (≠ I155), L166 (≠ N156), P167 (≠ A157), W168 (≠ F158), K192 (= K182), G225 (= G214), G229 (= G218), F243 (= F231), G245 (= G233), S246 (= S234), T249 (= T237), L252 (≠ V240), F253 (≠ I241), Y256 (≠ H244), C269 (≠ A258), G270 (≠ D259), C303 (= C296), H350 (≠ Q343), K353 (≠ S346), F400 (= F402)
8hapB Crystal structure of thermostable acetaldehyde dehydrogenase from hyperthermophilic archaeon sulfolobus tokodaii (see paper)
25% identity, 73% coverage: 58:436/520 of query aligns to 41:404/466 of 8hapB
- binding 2'-monophosphoadenosine-5'-diphosphate: I136 (= I155), L137 (≠ N156), F139 (= F158), K163 (= K182), S165 (≠ A184), I166 (≠ T185), S196 (= S216), G200 (≠ M220), G216 (= G233), S217 (= S234), T220 (= T237), I224 (≠ V247)
5j6bA Crystal structure of aldehyde dehydrogenase from burkholderia thailandensis in covelent complex with NADPH
29% identity, 70% coverage: 57:419/520 of query aligns to 61:402/481 of 5j6bA
- active site: N158 (= N159), K181 (= K182), E253 (= E257), C289 (= C296), E383 (= E400)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I154 (= I155), S155 (≠ N156), P156 (≠ A157), F157 (= F158), N158 (= N159), L163 (≠ G164), K181 (= K182), A183 (= A184), S184 (≠ T185), R214 (≠ S216), T232 (= T232), G233 (= G233), S234 (= S234), V237 (≠ A238), L241 (≠ R242), E253 (= E257), L254 (≠ A258), C289 (= C296), E383 (= E400), F385 (= F402)
Sites not aligning to the query:
3b4wA Crystal structure of mycobacterium tuberculosis aldehyde dehydrogenase complexed with NAD+
26% identity, 72% coverage: 64:436/520 of query aligns to 68:420/483 of 3b4wA
- active site: N154 (= N159), K177 (= K182), E251 (= E257), C285 (= C296), E384 (= E400)
- binding nicotinamide-adenine-dinucleotide: I150 (= I155), V151 (≠ N156), W153 (≠ F158), N154 (= N159), K177 (= K182), I210 (vs. gap), G213 (≠ A217), T228 (= T232), G229 (= G233), S230 (= S234), V233 (≠ T237), E236 (≠ V240), E251 (= E257), L252 (≠ A258), C285 (= C296), E384 (= E400), F386 (= F402)
Sites not aligning to the query:
P77674 Gamma-aminobutyraldehyde dehydrogenase; ABALDH; 1-pyrroline dehydrogenase; 4-aminobutanal dehydrogenase; 5-aminopentanal dehydrogenase; EC 1.2.1.19; EC 1.2.1.- from Escherichia coli (strain K12) (see paper)
26% identity, 82% coverage: 11:436/520 of query aligns to 9:414/474 of P77674
Query Sequence
>Ac3H11_3089 FitnessBrowser__acidovorax_3H11:Ac3H11_3089
MTELLPNFAAGRWQHGTGPGTALWDPVLGTALVRVDAAGLDLAEAFAFARDMGGAALRAA
TYRERAAMLAAVVKVLQTHRDSYYDIATANAGTVKNDSAVDIDGAIFTLGQYARWGDALG
DVRALRDGGAVKLGKEPVFLSQHLQVPRQGVALFINAFNFPAWGLWEKAAPALLSGMPVI
VKPATATAWLTQRMVQDVVDAGVLPVGALSVIAGSSAGLMDQLQPFDVVSFTGSAETAGV
IRAHAAVAQRSVRANIEADSLNSALLLPGEAPGSEAFNLLVREVVREMTVKSGQKCTAIR
RILVPADVYDAAAEAIGAKLAGITVGNPRNDGVRMGSLVSRAQLASVREGLVTLQAHATV
LHDGRHQPLVDADPAVAACMGPVLLGARDADAAQPVHDVEVFGPVATLLPYRDSAHAIAL
AQRGQGSLVTSLYGSDEAALAHTALAVAASHGRVHVVTPDVAQTHSGHGNVMPMSQHGGP
GRAGGGAELGGLRALDFYHQRSAVQASPAVLAALGLPDPA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory