SitesBLAST
Comparing Ac3H11_3127 FitnessBrowser__acidovorax_3H11:Ac3H11_3127 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P97852 Peroxisomal multifunctional enzyme type 2; MFE-2; 17-beta-hydroxysteroid dehydrogenase 4; 17-beta-HSD 4; D-bifunctional protein; DBP; Multifunctional protein 2; MFP-2; EC 1.1.1.n12; EC 4.2.1.107; EC 4.2.1.119 from Rattus norvegicus (Rat) (see paper)
56% identity, 76% coverage: 3:231/302 of query aligns to 5:230/735 of P97852
- 16:40 (vs. 14:38, 76% identical) binding
1gz6A (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 (see paper)
56% identity, 76% coverage: 3:231/302 of query aligns to 3:228/301 of 1gz6A
- active site: S149 (= S152), Y162 (= Y165), K166 (= K169)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), L19 (= L19), D38 (= D38), L39 (= L39), S73 (= S73), V74 (= V74), N97 (= N100), A98 (= A101), G99 (= G102), I100 (= I103), H121 (= H124), T147 (= T150), S149 (= S152), Y162 (= Y165), K166 (= K169), P192 (= P195), A194 (= A197), S196 (≠ T199), R197 (= R200), M198 (= M201)
1zbqA Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type 4 in complex with NAD
48% identity, 94% coverage: 3:285/302 of query aligns to 3:285/302 of 1zbqA
- active site: S149 (= S152), Y162 (= Y165), K166 (= K169)
- binding nicotinamide-adenine-dinucleotide: G14 (= G14), G18 (= G18), L19 (= L19), D38 (= D38), L39 (= L39), S73 (= S73), V74 (= V74), N97 (= N100), A98 (= A101), T147 (= T150), S149 (= S152), Y162 (= Y165), K166 (= K169), P192 (= P195), N193 (≠ T196), A194 (= A197), S196 (≠ T199), R197 (= R200), M198 (= M201)
P51659 Peroxisomal multifunctional enzyme type 2; MFE-2; 17-beta-hydroxysteroid dehydrogenase 4; 17-beta-HSD 4; D-bifunctional protein; DBP; Multifunctional protein 2; MFP-2; Short chain dehydrogenase/reductase family 8C member 1; EC 1.1.1.n12; EC 4.2.1.107; EC 4.2.1.119 from Homo sapiens (Human) (see 5 papers)
55% identity, 76% coverage: 3:231/302 of query aligns to 5:230/736 of P51659
- G16 (= G14) to S: in DBPD; no dehydrogenase activity; dbSNP:rs137853096
- R106 (≠ K107) to H: in dbSNP:rs25640
Sites not aligning to the query:
- 347 Y→A: No hydratase activity.
- 366 E→A: No hydratase activity.
- 370 D→A: No effect.
- 406 H→A: No effect.
- 408 E→A: No effect.
- 410 Y→A: No effect.
- 457 N → Y: in DBPD; the mutation leads to an unstable protein; dbSNP:rs137853097
- 490 D→A: No effect.
- 505 Y→A: Completely inactive.
- 510 D→A: No hydratase activity.
- 511 W → R: in dbSNP:rs11539471
- 515 H→A: Completely inactive.
- 517 D→A: No effect.
- 532 H→A: No effect.
- 559 I → V: in dbSNP:rs11205
P96825 Putative short-chain type dehydrogenase/reductase Rv0148; EC 1.1.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
49% identity, 92% coverage: 6:282/302 of query aligns to 5:281/286 of P96825
- K280 (≠ Q281) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P22414 Peroxisomal hydratase-dehydrogenase-epimerase; HDE; Multifunctional beta-oxidation protein; MFP; EC 4.2.1.119; EC 1.1.1.n12 from Candida tropicalis (Yeast) (see paper)
45% identity, 93% coverage: 3:284/302 of query aligns to 4:284/906 of P22414
Sites not aligning to the query:
- 699 binding
- 700 binding
- 729 binding
- 757 binding
- 808 binding
- 810 binding
- 831 binding
- 856 binding
- 857 binding
- 858 binding
1gz6B (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 (see paper)
52% identity, 76% coverage: 3:231/302 of query aligns to 3:205/278 of 1gz6B
- active site: S141 (= S152), Y154 (= Y165), K158 (= K169)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), L19 (= L19), D38 (= D38), L39 (= L39), S65 (= S73), V66 (= V74), N89 (= N100), A90 (= A101), G91 (= G102), H113 (= H124), T139 (= T150), S141 (= S152), Y154 (= Y165), K158 (= K169), P184 (= P195)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
38% identity, 75% coverage: 5:230/302 of query aligns to 5:228/244 of 4nbuB
- active site: G18 (= G18), N111 (≠ H124), S139 (= S152), Q149 (= Q162), Y152 (= Y165), K156 (= K169)
- binding acetoacetyl-coenzyme a: D93 (= D106), K98 (= K111), S139 (= S152), N146 (= N159), V147 (≠ F160), Q149 (= Q162), Y152 (= Y165), F184 (≠ A197), M189 (≠ T202), K200 (≠ A213)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), N17 (≠ G17), G18 (= G18), I19 (≠ L19), D38 (= D38), F39 (≠ L39), V59 (≠ A62), D60 (≠ S73), V61 (= V74), N87 (= N100), A88 (= A101), G89 (= G102), I90 (= I103), T137 (= T150), S139 (= S152), Y152 (= Y165), K156 (= K169), P182 (= P195), F184 (≠ A197), T185 (≠ A198), T187 (≠ R200), M189 (≠ T202)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
39% identity, 75% coverage: 9:233/302 of query aligns to 3:229/244 of 1edoA
- active site: G12 (= G18), S138 (= S152), Y151 (= Y165), K155 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G14), S10 (≠ G16), R11 (≠ G17), I13 (≠ L19), N31 (= N37), Y32 (≠ S46), A33 (≠ G47), R34 (≠ A48), S35 (≠ T49), D59 (≠ S73), V60 (= V74), N86 (= N100), A87 (= A101), S138 (= S152), Y151 (= Y165), K155 (= K169), P181 (= P195), G182 (vs. gap), I184 (≠ A197), S186 (≠ T199), M188 (= M201)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
41% identity, 74% coverage: 8:231/302 of query aligns to 7:229/247 of P73574
- A14 (= A15) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ F160) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K169) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ T196) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ M206) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
36% identity, 81% coverage: 1:244/302 of query aligns to 1:246/248 of Q9KJF1
- M1 (= M1) modified: Initiator methionine, Removed
- S15 (≠ G17) binding
- D36 (= D38) binding
- D62 (≠ S73) binding
- I63 (≠ V74) binding
- N89 (= N100) binding
- Y153 (= Y165) binding
- K157 (= K169) binding
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
35% identity, 79% coverage: 5:244/302 of query aligns to 2:245/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), M16 (≠ L19), D35 (= D38), I36 (≠ L39), I62 (≠ V74), N88 (= N100), G90 (= G102), I138 (≠ T150), S140 (= S152), Y152 (= Y165), K156 (= K169), I185 (≠ A198)
4nbwA Crystal structure of fabg from plesiocystis pacifica (see paper)
39% identity, 74% coverage: 8:231/302 of query aligns to 2:235/253 of 4nbwA
- active site: G12 (= G18), S146 (= S152), Y159 (= Y165), K163 (= K169)
- binding nicotinamide-adenine-dinucleotide: G8 (= G14), N11 (≠ G17), G12 (= G18), I13 (≠ L19), D32 (= D38), L33 (= L39), V57 (= V80), D58 (≠ E81), V59 (≠ A82), N85 (= N100), A86 (= A101), G87 (= G102), S146 (= S152), Y159 (= Y165), K163 (= K169), I192 (≠ A197), T194 (= T199)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
35% identity, 76% coverage: 5:235/302 of query aligns to 3:227/239 of 4nbtA
- active site: G16 (= G18), S132 (= S152), Y145 (= Y165), K149 (= K169)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), K15 (≠ G17), G16 (= G18), L17 (= L19), D36 (= D38), L37 (= L39), L52 (≠ A62), N53 (≠ S73), V54 (= V74), N80 (= N100), A81 (= A101), G82 (= G102), I130 (≠ T150), S132 (= S152), Y145 (= Y165), K149 (= K169), P177 (= P195), G178 (≠ T196), I180 (≠ A198), T182 (≠ R200)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
38% identity, 76% coverage: 5:235/302 of query aligns to 3:235/247 of 4jroC
- active site: G16 (= G18), S142 (= S152), Q152 (= Q162), Y155 (= Y165), K159 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ G16), R15 (≠ G17), G16 (= G18), I17 (≠ L19), N35 (= N37), Y36 (≠ D38), N37 (≠ L39), G38 (= G40), S39 (≠ G41), N63 (≠ S73), V64 (= V74), N90 (= N100), A91 (= A101), I93 (= I103), I113 (≠ V123), S142 (= S152), Y155 (= Y165), K159 (= K169), P185 (= P195), I188 (≠ A197), T190 (= T199)
7x5jC Acp-dependent oxoacyl reductase
43% identity, 63% coverage: 5:193/302 of query aligns to 2:184/256 of 7x5jC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G14), S13 (≠ G16), G15 (= G18), L16 (= L19), N36 (≠ S46), R37 (≠ A48), N38 (≠ T49), D62 (≠ S73), V63 (= V74), N89 (= N100), A90 (= A101), A91 (vs. gap), V114 (= V123), I141 (≠ T150), Y156 (= Y165), K160 (= K169)
Sites not aligning to the query:
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
38% identity, 70% coverage: 8:217/302 of query aligns to 5:198/246 of 3osuA
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
38% identity, 73% coverage: 3:222/302 of query aligns to 1:206/244 of 6t77A
- active site: G16 (= G18), S138 (= S152), Y151 (= Y165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ G16), R15 (≠ G17), T37 (≠ A48), L58 (≠ A69), N59 (= N70), V60 (= V74), A87 (= A101), G88 (= G102), I89 (= I103)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
37% identity, 70% coverage: 8:217/302 of query aligns to 2:195/239 of 3sj7A
- active site: G12 (= G18), S138 (= S152), Q148 (= Q162), Y151 (= Y165), K155 (= K169)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G14), S10 (≠ G16), R11 (≠ G17), I13 (≠ L19), N31 (= N37), Y32 (≠ D38), A33 (≠ L39), G34 (= G40), S35 (≠ G41), A58 (= A72), N59 (≠ S73), V60 (= V74), N86 (= N100), A87 (= A101), T109 (≠ V123), S138 (= S152), Y151 (= Y165), K155 (= K169), P181 (= P195), G182 (= G204)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 67% coverage: 3:205/302 of query aligns to 1:192/244 of P0AEK2
- GASR 12:15 (≠ GAGG 14:17) binding
- T37 (≠ A48) binding
- N---V 59:60 (≠ NGASV 70:74) binding
- N86 (= N100) binding
- Y151 (= Y165) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YGAAK 165:169) binding
- A154 (= A168) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K169) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ A197) binding
Sites not aligning to the query:
- 233 E→K: Decreases in the thermolability of the reductase; when associated with T-154.
Query Sequence
>Ac3H11_3127 FitnessBrowser__acidovorax_3H11:Ac3H11_3127
MGIDFQGRVAIVTGAGGGLGRQHALALAKRGAKVLVNDLGGAVDGSGATVSAAQAVVDEI
RAAGGEALANGASVTDFAAVEAMVQQAIDAWGRVDILVNNAGILRDKSFAKMDMADFNLV
VQVHLMGAAHCCKAVWPHMVAQQYGRIVMTTSSTGLYGNFGQANYGAAKLAQVGLMQTLS
IEGAKNNIHVNALAPTAATRMTEGLMPQEVLDALKPEAVVPAMLVLAHESAPTRTILCAG
AGTFEAAHITLTQGIHLGIGADVPEQLAARLAEVTERAGEQVPQSGAAQGTNEVGKALAA
RA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory