Comparing Ac3H11_3202 FitnessBrowser__acidovorax_3H11:Ac3H11_3202 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
37% identity, 93% coverage: 22:392/397 of query aligns to 5:372/380 of P54955
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 92% coverage: 30:396/397 of query aligns to 51:423/440 of O04373
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
38% identity, 90% coverage: 30:385/397 of query aligns to 19:377/389 of 4ewtA
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
40% identity, 86% coverage: 10:350/397 of query aligns to 2:344/398 of 6slfA
Sites not aligning to the query:
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 94% coverage: 23:396/397 of query aligns to 48:427/442 of P54968
3ramA Crystal structure of hmra (see paper)
24% identity, 83% coverage: 9:337/397 of query aligns to 4:318/391 of 3ramA
Sites not aligning to the query:
7yh4A Crystal structure of human cytosolic beta-alanyl lysine dipeptidase (pm20d2)
27% identity, 69% coverage: 29:302/397 of query aligns to 27:289/400 of 7yh4A
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
27% identity, 32% coverage: 199:327/397 of query aligns to 183:308/373 of 3rzaA
Sites not aligning to the query:
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
23% identity, 76% coverage: 30:330/397 of query aligns to 8:314/375 of 4pqaA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
23% identity, 76% coverage: 30:330/397 of query aligns to 8:314/376 of 4o23A
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
24% identity, 69% coverage: 38:309/397 of query aligns to 16:293/377 of 7t1qA
Sites not aligning to the query:
>Ac3H11_3202 FitnessBrowser__acidovorax_3H11:Ac3H11_3202
MGAVLPAAPKQDVERVEAGIAAFIHEFKALRRDLHEHPELSFQEHRTSAIVAERLAHWGY
SVTTGIAGTGVVGTLRKGQGSKALGIRADMDALPITEATGLPYASRNAGVMHACGHDGHT
TVLLAAARFLAESGRFDGTLNLIFQPAEEHGGGANRMIGEGLFERFPCDAVFGLHNWPCV
GEGHFGCVTGPAMASVDQITITVRGKGGHGAAPHETVDPVVASAHIITALQTVVSRNVDP
LDMGVVTVGSIHGGNAPNVVPESVELKLTARAFKPEVREILKQRIPAIARAQAESFGATA
EVLYLPGYPAVLNHEAETELARSVARDTFGDARVDAGFRPRTASEDFAFMLLKRPGSYVF
VGNGDGASLHSPYYDFNDAILAPSATYWVRLAERFLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory