Comparing Ac3H11_3217 FitnessBrowser__acidovorax_3H11:Ac3H11_3217 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
3ip9A Structure of atu2422-gaba receptor in complex with gaba (see paper)
31% identity, 88% coverage: 35:375/386 of query aligns to 3:338/348 of 3ip9A
3ip7A Structure of atu2422-gaba receptor in complex with valine (see paper)
31% identity, 88% coverage: 35:375/386 of query aligns to 3:338/348 of 3ip7A
3ip6A Structure of atu2422-gaba receptor in complex with proline (see paper)
31% identity, 88% coverage: 35:375/386 of query aligns to 3:338/348 of 3ip6A
3ip5A Structure of atu2422-gaba receptor in complex with alanine (see paper)
31% identity, 88% coverage: 35:375/386 of query aligns to 3:338/348 of 3ip5A
3ipcA Structure of atu2422-gaba f77a mutant receptor in complex with leucine (see paper)
31% identity, 88% coverage: 35:375/386 of query aligns to 3:338/348 of 3ipcA
1uskA L-leucine-binding protein with leucine bound (see paper)
27% identity, 89% coverage: 33:374/386 of query aligns to 1:338/345 of 1uskA
1usiA L-leucine-binding protein with phenylalanine bound (see paper)
27% identity, 89% coverage: 33:374/386 of query aligns to 1:338/345 of 1usiA
4q6bA Crystal structure of abc transporter substrate-binding protein fromdesulfitobacterium hafniense complex with leu
27% identity, 90% coverage: 33:378/386 of query aligns to 1:333/335 of 4q6bA
4mlcA Abc transporter substrate-binding protein fromdesulfitobacterium hafniense
27% identity, 90% coverage: 33:378/386 of query aligns to 1:334/336 of 4mlcA
1z18A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound valine (see paper)
26% identity, 89% coverage: 33:374/386 of query aligns to 1:336/344 of 1z18A
1z17A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound ligand isoleucine (see paper)
26% identity, 89% coverage: 33:374/386 of query aligns to 1:336/344 of 1z17A
1z16A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound leucine (see paper)
26% identity, 89% coverage: 33:374/386 of query aligns to 1:336/344 of 1z16A
4n0qB Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
26% identity, 85% coverage: 35:361/386 of query aligns to 3:326/345 of 4n0qB
4gnrA 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. Canada mdr_19a in complex with isoleucine
27% identity, 84% coverage: 34:357/386 of query aligns to 2:321/348 of 4gnrA
3td9A Crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution
26% identity, 85% coverage: 34:361/386 of query aligns to 1:324/350 of 3td9A
4q6wA Crystal structure of periplasmic binding protein type 1 from bordetella pertussis tohama i complexed with 3-hydroxy benzoic acid
23% identity, 82% coverage: 33:347/386 of query aligns to 2:336/376 of 4q6wA
7s6eB Crystal structure of urta from synechococcus cc9311 in complex with urea and calcium
28% identity, 25% coverage: 33:128/386 of query aligns to 8:105/400 of 7s6eB
Sites not aligning to the query:
8hicA Crystal structure of urta from prochlorococcus marinus str. Mit 9313 in complex with urea and calcium
28% identity, 25% coverage: 33:128/386 of query aligns to 3:100/395 of 8hicA
Sites not aligning to the query:
>Ac3H11_3217 FitnessBrowser__acidovorax_3H11:Ac3H11_3217
MNKHFNRRRFSASLALTAVATAAVLTGCGKVPDTIKIGVAQPLSGPLGALGQDLLNGVTL
AVDELNKSGYTVDGKRVTLEVVSVDDKADAATGKAVAQQLVDAGVVAVIGHLNSGVSIET
APIYAAKDIAQIAISTNPKFTQLGFSTTFRMVGNDTLQARAIGSFAATQLGAARYAALDD
GTPYGKGLADGAAEQLKAEKKEVVVRKSFDDKTVAFDELAGELKAAKVEVIVSTLNDFQA
LALLEALRKVDHTKVSLLGGDTIKTTDMTKGAGIVQGIYATSPVLEAKEFSTGKPFLEKY
IAAYKKPPAYGGHYSYDSTYVLSAAIQKAKSAAPKDITKAMHSINGYAPVIGTMTWDDKG
EQRYGAVGVYELRAGSWELRMRSDRW
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory