SitesBLAST
Comparing Ac3H11_3222 FitnessBrowser__acidovorax_3H11:Ac3H11_3222 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 79% coverage: 9:229/279 of query aligns to 8:224/378 of P69874
- C26 (≠ T27) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F28) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (= F50) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C59) mutation to T: Loss of ATPase activity and transport.
- L60 (= L65) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ C81) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V140) mutation to M: Loss of ATPase activity and transport.
- D172 (= D177) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
40% identity, 70% coverage: 40:235/279 of query aligns to 44:245/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12, 39, 40, 41
7aheC Opua inhibited inward facing (see paper)
40% identity, 70% coverage: 40:235/279 of query aligns to 44:245/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
7ahdC Opua (e190q) occluded (see paper)
39% identity, 70% coverage: 40:235/279 of query aligns to 44:245/260 of 7ahdC
- binding adenosine-5'-triphosphate: S61 (= S57), G62 (= G58), G64 (= G60), K65 (= K61), S66 (= S62), T67 (= T63), Q111 (= Q98), K161 (≠ G151), Q162 (≠ E152), S164 (= S154), G166 (= G156), M167 (= M157), Q188 (≠ E178), H221 (= H211)
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
40% identity, 71% coverage: 37:235/279 of query aligns to 19:217/393 of P9WQI3
- H193 (= H211) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
40% identity, 76% coverage: 26:238/279 of query aligns to 6:218/374 of 2awnB
8hprC Lpqy-sugabc in state 4 (see paper)
38% identity, 71% coverage: 37:235/279 of query aligns to 18:216/363 of 8hprC
- binding adenosine-5'-triphosphate: S38 (= S57), G39 (= G58), G41 (= G60), K42 (= K61), S43 (= S62), Q82 (= Q98), Q133 (≠ E152), G136 (= G155), G137 (= G156), Q138 (≠ M157), H192 (= H211)
- binding magnesium ion: S43 (= S62), Q82 (= Q98)
Sites not aligning to the query:
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
40% identity, 76% coverage: 26:238/279 of query aligns to 4:216/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ K32), S35 (= S57), G36 (= G58), C37 (= C59), G38 (= G60), K39 (= K61), S40 (= S62), T41 (= T63), R126 (≠ K148), A130 (≠ E152), S132 (= S154), G134 (= G156), Q135 (≠ M157)
8hprD Lpqy-sugabc in state 4 (see paper)
38% identity, 71% coverage: 37:235/279 of query aligns to 18:216/362 of 8hprD
- binding adenosine-5'-triphosphate: S38 (= S57), C40 (= C59), G41 (= G60), K42 (= K61), S43 (= S62), T44 (= T63), Q82 (= Q98), R129 (≠ K148), Q133 (≠ E152), S135 (= S154), G136 (= G155), G137 (= G156), Q159 (≠ E178), H192 (= H211)
- binding magnesium ion: S43 (= S62), Q82 (= Q98)
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
40% identity, 76% coverage: 26:238/279 of query aligns to 6:218/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ K32), S37 (= S57), G38 (= G58), C39 (= C59), G40 (= G60), K41 (= K61), S42 (= S62), T43 (= T63), Q81 (= Q98), R128 (≠ K148), A132 (≠ E152), S134 (= S154), G136 (= G156), Q137 (≠ M157), E158 (= E178), H191 (= H211)
- binding magnesium ion: S42 (= S62), Q81 (= Q98)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
40% identity, 76% coverage: 26:238/279 of query aligns to 6:218/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ K32), G38 (= G58), C39 (= C59), G40 (= G60), K41 (= K61), S42 (= S62), T43 (= T63), R128 (≠ K148), S134 (= S154), Q137 (≠ M157)
- binding beryllium trifluoride ion: S37 (= S57), G38 (= G58), K41 (= K61), Q81 (= Q98), S134 (= S154), G136 (= G156), H191 (= H211)
- binding magnesium ion: S42 (= S62), Q81 (= Q98)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
40% identity, 76% coverage: 26:238/279 of query aligns to 6:218/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ K32), V17 (≠ A37), G38 (= G58), C39 (= C59), G40 (= G60), K41 (= K61), S42 (= S62), T43 (= T63), R128 (≠ K148), A132 (≠ E152), S134 (= S154), Q137 (≠ M157)
- binding tetrafluoroaluminate ion: S37 (= S57), G38 (= G58), K41 (= K61), Q81 (= Q98), S134 (= S154), G135 (= G155), G136 (= G156), E158 (= E178), H191 (= H211)
- binding magnesium ion: S42 (= S62), Q81 (= Q98)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
40% identity, 76% coverage: 26:238/279 of query aligns to 6:218/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ K32), V17 (≠ A37), G38 (= G58), C39 (= C59), G40 (= G60), K41 (= K61), S42 (= S62), T43 (= T63), R128 (≠ K148), A132 (≠ E152), S134 (= S154), Q137 (≠ M157)
- binding magnesium ion: S42 (= S62), Q81 (= Q98)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
40% identity, 76% coverage: 26:238/279 of query aligns to 7:219/371 of P68187
- A85 (≠ S101) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (= K123) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ T133) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ A136) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ A138) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ T143) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G156) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D177) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
8hplC Lpqy-sugabc in state 1 (see paper)
38% identity, 71% coverage: 37:235/279 of query aligns to 16:214/384 of 8hplC
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
40% identity, 71% coverage: 37:235/279 of query aligns to 21:225/375 of 2d62A
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
41% identity, 72% coverage: 39:238/279 of query aligns to 20:219/369 of P19566
- L86 (= L102) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P179) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D184) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
1g291 Malk (see paper)
38% identity, 71% coverage: 37:235/279 of query aligns to 18:222/372 of 1g291
- binding magnesium ion: D69 (vs. gap), E71 (vs. gap), K72 (= K87), K79 (≠ P91), D80 (≠ E92)
- binding pyrophosphate 2-: S38 (= S57), G39 (= G58), C40 (= C59), G41 (= G60), K42 (= K61), T43 (≠ S62), T44 (= T63)
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
36% identity, 73% coverage: 33:235/279 of query aligns to 17:211/353 of 1vciA
Sites not aligning to the query:
2awnC Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
38% identity, 72% coverage: 39:238/279 of query aligns to 12:188/344 of 2awnC
Sites not aligning to the query:
Query Sequence
>Ac3H11_3222 FitnessBrowser__acidovorax_3H11:Ac3H11_3222
MNTTTTAASTHPSMSTKFIEVHGVEQTFKTAKGLFPALRDINLTIAKGEFVALIGHSGCG
KSTLLNLIAGLTTPTNGALLCANKEIKGPGPERAVVFQNHSLLPWLTCFDNIYLAVERVF
GAKETKAQLKARTDAALALVGLTPAGQKRPGEISGGMKQRVGIARALSMEPQVLLMDEPF
GALDALTRAKLQDELLEIVARTQSTVVMVTHDVDEAVLLSDKIVMMTNGPAATIGEVLAV
DLPRPRKRVELAEDPQYVHYRKAVIDFLYTRQGHVEKAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory