Comparing Ac3H11_3226 FitnessBrowser__acidovorax_3H11:Ac3H11_3226 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
53% identity, 92% coverage: 26:338/339 of query aligns to 1:310/310 of 7bbrA
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
53% identity, 92% coverage: 27:338/339 of query aligns to 1:309/310 of 7bcrA
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
53% identity, 92% coverage: 27:338/339 of query aligns to 1:309/310 of 7bcpA
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
53% identity, 92% coverage: 27:338/339 of query aligns to 1:309/310 of 7bcoA
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
53% identity, 92% coverage: 27:338/339 of query aligns to 1:309/310 of 7bcnA
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
39% identity, 89% coverage: 32:334/339 of query aligns to 3:303/303 of 4pddA
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
39% identity, 88% coverage: 33:331/339 of query aligns to 7:303/304 of 4pakA
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
39% identity, 88% coverage: 33:331/339 of query aligns to 6:302/303 of 4p9kA
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
42% identity, 83% coverage: 43:323/339 of query aligns to 14:292/301 of 4pdhA
4nq8B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate (see paper)
35% identity, 78% coverage: 33:297/339 of query aligns to 4:268/301 of 4nq8B
4xeqB Crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid
37% identity, 78% coverage: 43:306/339 of query aligns to 14:276/304 of 4xeqB
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
35% identity, 71% coverage: 48:289/339 of query aligns to 18:261/300 of 4n8yA
Sites not aligning to the query:
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
32% identity, 75% coverage: 50:302/339 of query aligns to 23:279/304 of 4x8rA
Sites not aligning to the query:
Q0B2F6 Solute-binding protein Bamb_6123 from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD)) (see paper)
33% identity, 88% coverage: 6:304/339 of query aligns to 9:297/328 of Q0B2F6
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
29% identity, 85% coverage: 46:334/339 of query aligns to 18:313/314 of 4p8bA
Sites not aligning to the query:
Q128M1 Solute-binding protein Bpro_3107 from Polaromonas sp. (strain JS666 / ATCC BAA-500) (see paper)
33% identity, 74% coverage: 48:297/339 of query aligns to 49:297/330 of Q128M1
Sites not aligning to the query:
4mhfA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-glucuronate, space group p21 (see paper)
33% identity, 74% coverage: 48:297/339 of query aligns to 19:267/301 of 4mhfA
Sites not aligning to the query:
4mijA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-galacturonate, space group p21 (see paper)
33% identity, 74% coverage: 48:297/339 of query aligns to 19:267/302 of 4mijA
Sites not aligning to the query:
4pbqA Crystal structure of a trap periplasmic solute binding protein from haemophilus influenzae rdaw (hicg_00826, target efi-510123) with bound l-gulonate (see paper)
35% identity, 69% coverage: 32:266/339 of query aligns to 3:236/304 of 4pbqA
4n17A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-galacturonate (see paper)
34% identity, 76% coverage: 48:304/339 of query aligns to 18:271/301 of 4n17A
Sites not aligning to the query:
>Ac3H11_3226 FitnessBrowser__acidovorax_3H11:Ac3H11_3226
MKTFRRTLLAALSVAAITCSFQAAAQDFKPRIIRFGYGLNEVSNQGRATKLFAEEVEKAS
GGKMKVRAIGAAALGSDVQMQQALIGGAQEMMVGSTATLVGITKEMAIWDTPFLFNNAKE
ADVVLDGPVGQKVMDKLQEKGLVGLVYWENGFRNLTNSKRPVNKLEDMDGIKLRVMQNNV
FLDSFKTLGANAVPLPFSELFTALETKTVDGQENPYNTILSSKFYEVQKYLTVTNHVYSP
WIVLVSKKYWDGLSKAEQKVLLDAAKKSRDFERQDTRAEADKALADLKGKGMQVNELPAA
EANRMREKLSAVNASIAANVGESLWKDVQGAVAQARAAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory