Comparing Ac3H11_3240 FitnessBrowser__acidovorax_3H11:Ac3H11_3240 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
8bftA The e. Coli trpd2 protein ybib in complex with a c-terminal peptide from obge (see paper)
37% identity, 99% coverage: 1:303/307 of query aligns to 2:309/321 of 8bftA
1zxyA Anthranilate phosphoribosyltransferase from sulfolobus solfataricus in complex with prpp and magnesium (see paper)
26% identity, 57% coverage: 7:182/307 of query aligns to 3:190/344 of 1zxyA
Sites not aligning to the query:
2gvqD Anthranilate phosphoribosyl-transferase (trpd) from s. Solfataricus in complex with anthranilate (see paper)
26% identity, 57% coverage: 7:182/307 of query aligns to 3:190/345 of 2gvqD
P50384 Anthranilate phosphoribosyltransferase; EC 2.4.2.18 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 2 papers)
26% identity, 57% coverage: 7:182/307 of query aligns to 3:190/345 of P50384
Sites not aligning to the query:
1gxbA Anthranilate phosphoribosyltransferase in complex with pyrophosphate and magnesium (see paper)
26% identity, 57% coverage: 7:182/307 of query aligns to 3:186/339 of 1gxbA
Sites not aligning to the query:
3gbrA Anthranilate phosphoribosyl-transferase (trpd) double mutant d83g f149s from s. Solfataricus (see paper)
25% identity, 57% coverage: 7:182/307 of query aligns to 3:187/341 of 3gbrA
Sites not aligning to the query:
1kgzB Crystal structure analysis of the anthranilate phosphoribosyltransferase from erwinia carotovora (current name, pectobacterium carotovorum) (see paper)
24% identity, 68% coverage: 17:226/307 of query aligns to 12:225/330 of 1kgzB
>Ac3H11_3240 FitnessBrowser__acidovorax_3H11:Ac3H11_3240
MGISQYIKEIGRGARGAKPLSREQATDLFGQVLDGQVSDLEIGAFCLAMRIKGETAEEMC
GFLDATHSRLALLPATDRPLIVLPSYNGARKLPVLTPLLALLLAREGLPVLLHGMRTEAR
RILASDVLLALDVPALTAPEKVANGTVRHIHTQHLHAGLARLLAVREVVGLRNPGHSVVK
LMSPCAGASVVVTAYTHPEYFEMLQTTFRTLGMSALLSRGLEGEVATDPRRTPRYDGFVR
GVHQVLDAQQPGTASEVPGLPAEIDVATTAVYTRRVLAGELPIPPAIERQVEHILQLADQ
TASETSP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory