Comparing Ac3H11_3297 FitnessBrowser__acidovorax_3H11:Ac3H11_3297 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
54% identity, 97% coverage: 7:348/354 of query aligns to 3:333/1227 of P13009
Sites not aligning to the query:
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
52% identity, 97% coverage: 2:346/354 of query aligns to 12:344/1265 of Q99707
Sites not aligning to the query:
4cczA Crystal structure of human 5-methyltetrahydrofolate-homocysteine methyltransferase, the homocysteine and folate binding domains
51% identity, 94% coverage: 15:346/354 of query aligns to 9:304/611 of 4cczA
Sites not aligning to the query:
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
37% identity, 95% coverage: 16:351/354 of query aligns to 9:314/841 of 8g3hA
Sites not aligning to the query:
3bofA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ and homocysteine (see paper)
29% identity, 93% coverage: 11:340/354 of query aligns to 6:287/560 of 3bofA
1q8jA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) (see paper)
29% identity, 93% coverage: 11:340/354 of query aligns to 6:287/559 of 1q8jA
Sites not aligning to the query:
Q93088 Betaine--homocysteine S-methyltransferase 1; EC 2.1.1.5 from Homo sapiens (Human) (see 4 papers)
23% identity, 80% coverage: 71:352/354 of query aligns to 49:324/406 of Q93088
1lt8A Reduced homo sapiens betaine-homocysteine s-methyltransferase in complex with s-(delta-carboxybutyl)-l-homocysteine (see paper)
23% identity, 80% coverage: 71:352/354 of query aligns to 39:301/348 of 1lt8A
Sites not aligning to the query:
O09171 Betaine--homocysteine S-methyltransferase 1; EC 2.1.1.5 from Rattus norvegicus (Rat) (see 2 papers)
23% identity, 80% coverage: 71:352/354 of query aligns to 49:324/407 of O09171
Sites not aligning to the query:
1umyD Bhmt from rat liver (see paper)
23% identity, 80% coverage: 71:352/354 of query aligns to 40:301/381 of 1umyD
5dmmA Crystal structure of the homocysteine methyltransferase mmum from escherichia coli, metallated form (see paper)
25% identity, 90% coverage: 18:336/354 of query aligns to 10:284/288 of 5dmmA
4m3pA Betaine-homocysteine s-methyltransferase from homo sapiens complexed with homocysteine (see paper)
22% identity, 80% coverage: 71:352/354 of query aligns to 40:293/370 of 4m3pA
Sites not aligning to the query:
>Ac3H11_3297 FitnessBrowser__acidovorax_3H11:Ac3H11_3297
MQALHYTRAAQLPDILAQRIVILDGAMGTMIQRFKLGEAQYRGEGYTGPGKAGDRFKDFA
YDVKGNNELLSLTRPDVISDIHERYLAAGADLIETNTFGATTIAQEDYHMANLAREMNLR
SAELARAACDKYSTPDKPRFVAGALGPTPKTASISPDVNDPGARNVDFEALRAAYYEQTE
ALVEGGSDVLLVETIFDTLNAKAALFAIDEYFENSGQRLPLIISGTVTDASGRILSGQTV
TAFWHSVRHSRPLAIGLNCALGATLMRPYIQELNRVAEDTFISCYPNAGLPNPMSDTGFD
ETPEITSRLVHEFAAEGLVNILGGCCGTTPDHIGAIAKAVESVPTRKMFYPAEA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory