Comparing Ac3H11_3325 FitnessBrowser__acidovorax_3H11:Ac3H11_3325 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
51% identity, 92% coverage: 20:253/253 of query aligns to 6:241/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
51% identity, 92% coverage: 20:253/253 of query aligns to 6:241/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
51% identity, 92% coverage: 20:253/253 of query aligns to 6:241/241 of 3vvdA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
51% identity, 92% coverage: 20:253/253 of query aligns to 2:237/237 of 3vv5A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
40% identity, 86% coverage: 31:248/253 of query aligns to 4:225/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
39% identity, 85% coverage: 31:246/253 of query aligns to 4:225/226 of 4zv1A
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
34% identity, 89% coverage: 24:248/253 of query aligns to 3:229/229 of 6svfA
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
31% identity, 86% coverage: 30:246/253 of query aligns to 2:221/226 of 8eyzA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
32% identity, 86% coverage: 31:248/253 of query aligns to 1:224/224 of 4ymxA
2ylnA Crystal structure of the l-cystine solute receptor of neisseria gonorrhoeae in the closed conformation (see paper)
30% identity, 91% coverage: 24:253/253 of query aligns to 7:240/240 of 2ylnA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
29% identity, 87% coverage: 32:252/253 of query aligns to 6:230/235 of 2pvuA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
29% identity, 87% coverage: 32:252/253 of query aligns to 2:226/231 of 2q2cA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
29% identity, 87% coverage: 32:252/253 of query aligns to 12:236/241 of 2q2aA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
30% identity, 89% coverage: 23:246/253 of query aligns to 2:228/229 of 5t0wA
8b5dA Exploring the ligand binding and conformational dynamics of receptor domain 1 of the abc transporter glnpq
31% identity, 84% coverage: 33:245/253 of query aligns to 2:219/223 of 8b5dA
3tqlA Structure of the amino acid abc transporter, periplasmic amino acid- binding protein from coxiella burnetii. (see paper)
33% identity, 85% coverage: 33:246/253 of query aligns to 4:225/225 of 3tqlA
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
30% identity, 87% coverage: 32:250/253 of query aligns to 27:257/260 of P02910
Sites not aligning to the query:
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
30% identity, 87% coverage: 32:250/253 of query aligns to 5:235/238 of 1hslA
6fxgB Crystal structure of substrate binding domain 1 (sbd1) of abc transporter glnpq in complex with asparagine
31% identity, 84% coverage: 33:245/253 of query aligns to 5:222/226 of 6fxgB
8b5eA Exploring the ligand binding and conformational dynamics of receptor domain 1 of the abc transporter glnpq
31% identity, 84% coverage: 33:245/253 of query aligns to 4:221/225 of 8b5eA
>Ac3H11_3325 FitnessBrowser__acidovorax_3H11:Ac3H11_3325
MKLFKAVATALALCAAFAAQARTLDEVKKDGKILIATEGQFAPFNFFNGTTLTGFEVEVA
ELVAKKMGLTIQWKTLGFDALLTGLRQDRWDLVIASHGITEERAKAVTFTEPHYCSGGMI
IAMDPAIKSAKDLAGKIVAVQTGTSYLENVQKVSSIKEMKNFPTDVDARSALNSRRVDAW
VTDRFVAKAVAEKNPGAGFKLGDMLFIERIAAAVAKGNSSLAGGWNKALAEVMADGSYAA
LSKKYFNEDVRCQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory