Comparing Ac3H11_3354 FitnessBrowser__acidovorax_3H11:Ac3H11_3354 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 86% coverage: 15:238/260 of query aligns to 22:247/265 of P07821
Q9LVM1 ABC transporter B family member 25, mitochondrial; ABC transporter ABCB.25; AtABCB25; ABC transporter of the mitochondrion 3; AtATM3; Iron-sulfur clusters transporter ATM3; Protein STARIK 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 84% coverage: 4:221/260 of query aligns to 478:695/728 of Q9LVM1
7n5aA Structure of atatm3 in the closed conformation (see paper)
29% identity, 84% coverage: 4:221/260 of query aligns to 351:568/589 of 7n5aA
7n59A Structure of atatm3 in the inward-facing conformation with gssg bound (see paper)
29% identity, 84% coverage: 4:221/260 of query aligns to 352:569/590 of 7n59A
Sites not aligning to the query:
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
29% identity, 88% coverage: 9:236/260 of query aligns to 7:233/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
29% identity, 88% coverage: 9:236/260 of query aligns to 7:233/238 of 6s8gA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
29% identity, 88% coverage: 9:236/260 of query aligns to 7:233/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
29% identity, 88% coverage: 9:236/260 of query aligns to 7:233/234 of 4p31A
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
29% identity, 88% coverage: 9:236/260 of query aligns to 7:233/235 of 6mhzA
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
29% identity, 88% coverage: 9:236/260 of query aligns to 7:233/233 of 6b8bA
1l7vC Bacterial abc transporter involved in b12 uptake (see paper)
34% identity, 81% coverage: 28:238/260 of query aligns to 22:231/231 of 1l7vC
7pruA Structure of ctatm1 in the inward-facing partially occluded with cargo bound (see paper)
28% identity, 84% coverage: 5:222/260 of query aligns to 347:566/582 of 7pruA
Sites not aligning to the query:
6mbnA Lptb e163q in complex with atp (see paper)
28% identity, 88% coverage: 9:236/260 of query aligns to 8:234/241 of 6mbnA
7pr1A Structure of ctatm1 in the occluded conformation with atp bound (see paper)
28% identity, 84% coverage: 5:222/260 of query aligns to 350:569/587 of 7pr1A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 82% coverage: 14:226/260 of query aligns to 27:235/378 of P69874
Sites not aligning to the query:
4fi3C Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state (see paper)
33% identity, 87% coverage: 28:254/260 of query aligns to 22:246/248 of 4fi3C
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
27% identity, 92% coverage: 5:242/260 of query aligns to 4:241/242 of 3c4jA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 86% coverage: 19:242/260 of query aligns to 17:239/241 of 4u00A
Sites not aligning to the query:
5x40A Structure of a cbio dimer bound with amppcp (see paper)
35% identity, 91% coverage: 5:240/260 of query aligns to 5:258/280 of 5x40A
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
26% identity, 89% coverage: 5:236/260 of query aligns to 3:233/240 of 6mjpA
>Ac3H11_3354 FitnessBrowser__acidovorax_3H11:Ac3H11_3354
MKDGLQIDQLTAGYPGRPVLQGVTLPGVPAGTLVAVVGPNAVGKSTLLKAVAGLRPAQGR
VWLEGTDLATLAPRERLRRVGYLPQALPQSTSLVAYETWQSALRASRSEWSTAQREAAIE
SVVATLGLQALALRRLDELSGGQRQMVGLAQVIVRAPRLLLLDEPTSALDLRWQLQVLQA
VRALVLQQGAIGLVAVHDLNLALRFCQHVLVLGGGSVLAAGAPATVLTPALLQRAYGVLA
RVERCSEGHLLVLADAALPQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory