Comparing Ac3H11_336 FitnessBrowser__acidovorax_3H11:Ac3H11_336 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5hwnB Crystal structure of keto-deoxy-d-galactarate dehydratase complexed with pyruvate (see paper)
54% identity, 87% coverage: 40:336/342 of query aligns to 1:296/310 of 5hwnB
4ur8A Crystal structure of keto-deoxy-d-galactarate dehydratase complexed with 2-oxoadipic acid (see paper)
54% identity, 87% coverage: 40:336/342 of query aligns to 1:296/304 of 4ur8A
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
31% identity, 77% coverage: 76:340/342 of query aligns to 27:289/292 of Q07607
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
30% identity, 63% coverage: 58:273/342 of query aligns to 10:226/296 of 7mjfA
Sites not aligning to the query:
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
30% identity, 63% coverage: 58:273/342 of query aligns to 10:226/296 of 7lvlA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
29% identity, 83% coverage: 58:340/342 of query aligns to 10:291/294 of Q8UGL3
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
30% identity, 64% coverage: 58:275/342 of query aligns to 10:228/294 of 4i7wA
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
30% identity, 66% coverage: 47:273/342 of query aligns to 1:225/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
30% identity, 66% coverage: 47:273/342 of query aligns to 1:225/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
30% identity, 66% coverage: 47:273/342 of query aligns to 1:225/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
30% identity, 66% coverage: 47:273/342 of query aligns to 1:225/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
30% identity, 66% coverage: 47:273/342 of query aligns to 1:225/291 of 3rk8A
Sites not aligning to the query:
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
30% identity, 66% coverage: 47:273/342 of query aligns to 1:225/291 of 3pueB
Sites not aligning to the query:
5j5dA Crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid (see paper)
26% identity, 86% coverage: 44:337/342 of query aligns to 4:291/297 of 5j5dA
1xxxA Crystal structure of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis (see paper)
26% identity, 86% coverage: 44:337/342 of query aligns to 3:290/296 of 1xxxA
P9WP25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
26% identity, 86% coverage: 44:337/342 of query aligns to 7:294/300 of P9WP25
3l21B The crystal structure of a dimeric mutant of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis - dhdps- a204r
26% identity, 86% coverage: 44:337/342 of query aligns to 2:289/295 of 3l21B
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
29% identity, 84% coverage: 53:339/342 of query aligns to 8:292/295 of 5ktlA
3di1B Crystal structure of the staphylococcus aureus dihydrodipicolinate synthase-pyruvate complex (see paper)
29% identity, 60% coverage: 76:279/342 of query aligns to 30:235/291 of 3di1B
Sites not aligning to the query:
Q5HG25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Staphylococcus aureus (strain COL) (see paper)
29% identity, 60% coverage: 76:279/342 of query aligns to 30:235/295 of Q5HG25
>Ac3H11_336 FitnessBrowser__acidovorax_3H11:Ac3H11_336
MMLTLTFAYSSGIFQIHQEKNQLVRPLDLPSTIHRARFTMTPQDLKTIMGSGLLSFPITD
FDAQGNFRPKTYIERLEWLAPYGASALFAAGGTGEYFSLSGPEYSEVIKTAVDTCRGKVP
IIAGAGGPTRTAIAHAQEAERLGAHGILLLPHYLTEAGQEGLIAHVAQVCNSVKFGVIVY
NRDRTKLTAESLAILAERCPNLIGFKDGVGNIETMSSIYMKMGDRFSYLGGLPTAEVYAA
AYKALGTPVYSSAVFNFIPKTAMEFYKAVAADDIATQHKLLKEFFMPYLAIRNRVEGYGV
SIIKAGARIVGHDGGPVRAPLTDLKPHEVEELAALIKKLGPQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory