SitesBLAST
Comparing Ac3H11_3369 Branched-chain amino acid aminotransferase (EC 2.6.1.42) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4whxA X-ray crystal structure of an amino acid aminotransferase from burkholderia pseudomallei bound to the co-factor pyridoxal phosphate
71% identity, 100% coverage: 1:305/305 of query aligns to 2:306/306 of 4whxA
2ej0B Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase with pyridoxamine 5'-phosphate
53% identity, 99% coverage: 4:305/305 of query aligns to 3:304/305 of 2ej0B
- active site: F35 (= F36), G37 (= G38), K158 (= K158), E192 (= E192), L215 (= L216)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R58 (= R59), Y163 (= Y163), E192 (= E192), G195 (= G195), E196 (= E196), L215 (= L216), G217 (= G218), I218 (= I219), T219 (= T220), G254 (= G255), T255 (= T256)
2ej3A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with gabapentin
50% identity, 99% coverage: 4:305/305 of query aligns to 3:296/297 of 2ej3A
- active site: F35 (= F36), G37 (= G38), K150 (= K158), E184 (= E192), L207 (= L216)
- binding [1-(aminomethyl)cyclohexyl]acetic acid: G187 (= G195), G246 (= G255), T247 (= T256), A248 (= A257)
- binding pyridoxal-5'-phosphate: R58 (= R59), K150 (= K158), Y155 (= Y163), E184 (= E192), G187 (= G195), L207 (= L216), G209 (= G218), I210 (= I219), T211 (= T220), G246 (= G255), T247 (= T256)
2eiyA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with 4-methylvaleric acid
50% identity, 99% coverage: 4:305/305 of query aligns to 3:296/297 of 2eiyA
- active site: F35 (= F36), G37 (= G38), K150 (= K158), E184 (= E192), L207 (= L216)
- binding 4-methyl valeric acid: F35 (= F36), Y94 (= Y95), T247 (= T256), A248 (= A257)
- binding pyridoxal-5'-phosphate: R58 (= R59), K150 (= K158), Y155 (= Y163), E184 (= E192), G187 (= G195), E188 (= E196), L207 (= L216), G209 (= G218), I210 (= I219), T211 (= T220), G246 (= G255), T247 (= T256)
1wrvA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase
50% identity, 99% coverage: 4:305/305 of query aligns to 3:296/297 of 1wrvA
- active site: F35 (= F36), G37 (= G38), K150 (= K158), E184 (= E192), L207 (= L216)
- binding pyridoxal-5'-phosphate: R58 (= R59), K150 (= K158), Y155 (= Y163), E184 (= E192), G187 (= G195), L207 (= L216), G209 (= G218), I210 (= I219), T211 (= T220), T247 (= T256)
2ej2A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate
51% identity, 99% coverage: 4:305/305 of query aligns to 3:293/294 of 2ej2A
- active site: F35 (= F36), G37 (= G38), K147 (= K158), E181 (= E192), L204 (= L216)
- binding 4-[(1,3-dicarboxy-propylamino)-methyl]-3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridinium: R58 (= R59), Y94 (= Y95), Y152 (= Y163), E181 (= E192), G184 (= G195), E185 (= E196), L204 (= L216), G206 (= G218), I207 (= I219), T208 (= T220), T244 (= T256), A245 (= A257)
1iyeA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase (see paper)
45% identity, 98% coverage: 8:305/305 of query aligns to 5:303/304 of 1iyeA
- active site: F33 (= F36), G35 (= G38), K156 (= K158), A157 (= A159), E190 (= E192), L214 (= L216)
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: R56 (= R59), Y92 (= Y95), Y126 (= Y128), K156 (= K158), Y161 (= Y163), E190 (= E192), G193 (= G195), E194 (= E196), N195 (= N197), L214 (= L216), G216 (= G218), I217 (= I219), T218 (= T220), G253 (= G255), T254 (= T256), A255 (= A257)
1iydA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase (see paper)
45% identity, 98% coverage: 8:305/305 of query aligns to 5:303/304 of 1iydA
- active site: F33 (= F36), G35 (= G38), K156 (= K158), A157 (= A159), E190 (= E192), L214 (= L216)
- binding glutaric acid: Y92 (= Y95), Y126 (= Y128), A255 (= A257)
- binding pyridoxal-5'-phosphate: R56 (= R59), K156 (= K158), Y161 (= Y163), E190 (= E192), G193 (= G195), E194 (= E196), L214 (= L216), G216 (= G218), I217 (= I219), T218 (= T220), T254 (= T256)
1i1mA Crystal structure of escherichia coli branched-chain amino acid aminotransferase. (see paper)
45% identity, 98% coverage: 8:305/305 of query aligns to 5:303/304 of 1i1mA
- active site: K156 (= K158)
- binding 4-methyl valeric acid: Y92 (= Y95), K156 (= K158), T254 (= T256), A255 (= A257)
- binding pyridoxal-5'-phosphate: R56 (= R59), K156 (= K158), Y161 (= Y163), E190 (= E192), G193 (= G195), E194 (= E196), L214 (= L216), G216 (= G218), I217 (= I219), T218 (= T220), G253 (= G255), T254 (= T256)
1i1lA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase. (see paper)
45% identity, 98% coverage: 8:305/305 of query aligns to 5:303/304 of 1i1lA
- active site: K156 (= K158)
- binding 2-methylleucine: Y92 (= Y95), K156 (= K158), T254 (= T256), A255 (= A257)
- binding pyridoxal-5'-phosphate: R56 (= R59), K156 (= K158), Y161 (= Y163), E190 (= E192), G193 (= G195), G216 (= G218), I217 (= I219), T218 (= T220), T254 (= T256)
6thqB Crystal structure of branched-chain aminotransferase from thermophilic archaea thermoproteus uzoniensis with norvaline
46% identity, 98% coverage: 7:305/305 of query aligns to 8:300/301 of 6thqB
- active site: F37 (= F36), K156 (= K158), E190 (= E192), L214 (= L216)
- binding pyridoxal-5'-phosphate: R60 (= R59), K156 (= K158), Y161 (= Y163), E190 (= E192), N195 (= N197), L214 (= L216), G216 (= G218), I217 (= I219), T218 (= T220), T254 (= T256)
- binding 2-[o-phosphonopyridoxyl]-amino-pentanoic acid: R60 (= R59), Y97 (= Y95), K156 (= K158), Y161 (= Y163), E190 (= E192), G193 (= G195), E194 (= E196), N195 (= N197), G216 (= G218), I217 (= I219), T218 (= T220), G253 (= G255), T254 (= T256), A255 (= A257)
5mr0D Thermophilic archaeal branched-chain amino acid transaminases from geoglobus acetivorans and archaeoglobus fulgidus: biochemical and structural characterisation (see paper)
41% identity, 92% coverage: 8:287/305 of query aligns to 4:277/290 of 5mr0D
- active site: F32 (= F36), G34 (= G38), K150 (= K158), E183 (= E192), L206 (= L216)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R51 (= R59), G100 (= G108), L101 (≠ V109), K150 (= K158), Y154 (= Y163), E183 (= E192), G186 (= G195), D187 (≠ E196), L206 (= L216), I209 (= I219), T210 (= T220), G245 (= G255), T246 (= T256)
6q8eA Crystal structure of branched-chain amino acid aminotransferase from thermobaculum terrenum in pmp-form (see paper)
37% identity, 98% coverage: 8:305/305 of query aligns to 6:304/307 of 6q8eA
- active site: F34 (= F36), K156 (= K158), E190 (= E192), L214 (= L216)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R59 (= R59), K156 (= K158), Y161 (= Y163), E190 (= E192), G193 (= G195), S194 (≠ E196), C195 (≠ N197), L214 (= L216), S216 (≠ G218), I217 (= I219), T218 (= T220), G254 (= G255), T255 (= T256)
5e25A Crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate (see paper)
37% identity, 92% coverage: 8:287/305 of query aligns to 5:278/290 of 5e25A
- active site: F33 (= F36), G35 (= G38), K151 (= K158), E184 (= E192), L207 (= L216)
- binding 2-oxoglutaric acid: Y88 (= Y95), K151 (= K158), T247 (= T256), A248 (= A257)
- binding pyridoxal-5'-phosphate: R52 (= R59), K151 (= K158), Y155 (= Y163), E184 (= E192), G187 (= G195), D188 (≠ E196), L207 (= L216), G209 (= G218), I210 (= I219), T211 (= T220), G246 (= G255), T247 (= T256)
7neaA Crystal structure of branched-chain amino acid aminotransferase from thermobaculum terrenum (m3 mutant). (see paper)
36% identity, 98% coverage: 8:305/305 of query aligns to 6:304/309 of 7neaA
- active site: F34 (= F36), K156 (= K158), E190 (= E192), L214 (= L216)
- binding pyridoxal-5'-phosphate: R59 (= R59), K156 (= K158), Y161 (= Y163), E190 (= E192), G193 (= G195), S194 (≠ E196), L214 (= L216), S216 (≠ G218), I217 (= I219), T218 (= T220), T255 (= T256)
6h65C Crystal structure of the branched-chain-amino-acid aminotransferase from haliangium ochraceum
32% identity, 97% coverage: 9:305/305 of query aligns to 8:306/308 of 6h65C
- active site: F35 (= F36), K158 (= K158), E192 (= E192), L216 (= L216)
- binding pyridoxal-5'-phosphate: R60 (= R59), K158 (= K158), Y163 (= Y163), E192 (= E192), A196 (≠ E196), L216 (= L216), S218 (≠ G218), V219 (≠ I219), T220 (= T220), G256 (= G255), T257 (= T256)
7p3tB Transaminase of gamma-proteobacterium (see paper)
33% identity, 92% coverage: 8:288/305 of query aligns to 6:280/299 of 7p3tB
- binding pyridoxal-5'-phosphate: R53 (= R59), K153 (≠ A159), R157 (≠ Y163), E186 (= E192), S187 (≠ G193), A188 (= A194), A189 (≠ G195), S190 (≠ E196), G210 (= G218), I211 (= I219), T212 (= T220), T248 (= T256)
8ivpB Crystal structure of mv in complex with llp and fru from mycobacterium vanbaalenii
31% identity, 94% coverage: 6:292/305 of query aligns to 29:311/322 of 8ivpB
5fr9A Structure of transaminase ata-117 arrmut11 from arthrobacter sp. Knk168 inhibited with 1-(4-bromophenyl)-2-fluoroethylamine (see paper)
27% identity, 93% coverage: 6:290/305 of query aligns to 26:306/319 of 5fr9A
- active site: Y56 (≠ F36), K177 (≠ A159), E210 (= E192), L232 (= L216)
- binding [4-[3-(4-bromophenyl)-3-oxidanylidene-propyl]-6-methyl-5-oxidanyl-pyridin-3-yl]methyl phosphate: R75 (= R59), K177 (≠ A159), E210 (= E192), G213 (= G195), F214 (≠ E196), L232 (= L216), G234 (= G218), I235 (= I219), T236 (= T220), T272 (= T256)
6xwbA Crystal structure of an r-selective transaminase from thermomyces stellatus. (see paper)
27% identity, 94% coverage: 5:290/305 of query aligns to 27:307/319 of 6xwbA
- binding pyridoxal-5'-phosphate: R77 (= R59), K178 (≠ A159), F185 (≠ S166), E211 (= E192), G214 (= G195), F215 (≠ E196), N216 (= N197), L233 (= L216), G235 (= G218), V236 (≠ I219), T237 (= T220), T273 (= T256)
Query Sequence
>Ac3H11_3369 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
MADRDGKIWMDGQMVDWRDAKIHVLTHTLHYGCGAFEGVRAYNTANGTAIFRLEEHTDRL
FNSAKILRMKIPFTKEEVNEAQKAVVRENKLESCYLRPLTWIGSQKLGVSPKGNQIHLMV
AAWAWGAYLGEEGLKRGIRVKTSSYTRHHVNITMTQAKAVSNYTNSILANMEALDDGYDE
ALLLDSSGFVSEGAGENIFVIKNGVIYTPDLSAGALNGITRNTVFHIAKDLGLEIVQKRI
TRDEVYIADEAFFTGTAAEVTPIRELDRIELGSGSRGPITEKIQSAFFDIVNGRNSNYAH
WLTKV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory