SitesBLAST
Comparing Ac3H11_3398 FitnessBrowser__acidovorax_3H11:Ac3H11_3398 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9YHT2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; Iron-sulfur subunit of complex II; Ip; EC 1.3.5.1 from Gallus gallus (Chicken) (see 2 papers)
30% identity, 23% coverage: 6:102/417 of query aligns to 183:280/290 of Q9YHT2
- C196 (= C25) binding
- C199 (= C28) binding
- C202 (= C31) binding
- C206 (= C35) binding
- W211 (≠ L40) binding
- C253 (= C75) binding
- C259 (= C81) binding
- C263 (= C85) binding
Sites not aligning to the query:
- 103 binding
- 108 binding
- 111 binding
- 123 binding
1yq3B Avian respiratory complex ii with oxaloacetate and ubiquinone (see paper)
30% identity, 23% coverage: 6:102/417 of query aligns to 140:237/242 of 1yq3B
- binding fe3-s4 cluster: C163 (= C35), Y173 (≠ L45), P176 (= P48), C210 (= C75), T212 (= T77), I213 (≠ C78), M214 (≠ R79), N215 (= N80), C216 (= C81)
- binding iron/sulfur cluster: C153 (= C25), I154 (≠ V26), L155 (≠ H27), C156 (= C28), A157 (≠ G29), C159 (= C31), A177 (≠ R49), C220 (= C85), P221 (= P86)
- binding Coenzyme Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-isomer: P164 (= P36), W168 (≠ L40), I213 (≠ C78)
Sites not aligning to the query:
P21801 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; Iron-sulfur subunit of complex II; Ip; EC 1.3.5.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
32% identity, 21% coverage: 6:92/417 of query aligns to 166:253/266 of P21801
Sites not aligning to the query:
- 260 K→T: Abolishes SDH activity. No effect on complex assembly and stability; when associated with T-261.
- 260:266 mutation Missing: Abolishes SDH activity and complex assembly.
- 261 K→T: Abolishes SDH activity. No effect on complex assembly and stability; when associated with T-260.
6myqB Avian mitochondrial complex ii with ferulenol bound (see paper)
30% identity, 23% coverage: 6:102/417 of query aligns to 137:234/239 of 6myqB
- binding 4-oxidanyl-3-[(2~{E},6~{E})-3,7,11-trimethyldodeca-2,6,10-trienyl]chromen-2-one: W165 (≠ L40), I210 (≠ C78)
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), T209 (= T77), I210 (≠ C78), M211 (≠ R79), N212 (= N80), C213 (= C81)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), C156 (= C31), A174 (≠ R49), C217 (= C85), P218 (= P86)
Sites not aligning to the query:
Q007T0 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; Iron-sulfur subunit of complex II; Ip; EC 1.3.5.1 from Sus scrofa (Pig) (see paper)
29% identity, 23% coverage: 6:102/417 of query aligns to 173:270/280 of Q007T0
- C186 (= C25) binding
- C189 (= C28) binding
- C192 (= C31) binding
- C196 (= C35) binding
- W201 (≠ L40) binding
- C243 (= C75) binding
- C249 (= C81) binding
- C253 (= C85) binding
Sites not aligning to the query:
- 93 binding
- 98 binding
- 101 binding
- 113 binding
6mysB Avian mitochondrial complex ii with atpenin a5 bound, sidechain outside (see paper)
30% identity, 23% coverage: 6:102/417 of query aligns to 138:235/240 of 6mysB
- binding 3-[(2s,4s,5r)-5,6-dichloro-2,4-dimethyl-1-oxohexyl]-4-hydroxy-5,6-dimethoxy-2(1h)-pyridinone: P162 (= P36), W166 (≠ L40), H209 (≠ L76), I211 (≠ C78)
- binding fe3-s4 cluster: C161 (= C35), Y171 (≠ L45), P174 (= P48), C208 (= C75), T210 (= T77), I211 (≠ C78), M212 (≠ R79), N213 (= N80), C214 (= C81)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), A155 (≠ G29), C157 (= C31), A175 (≠ R49), C218 (= C85)
Sites not aligning to the query:
6myrB Avian mitochondrial complex ii with thiapronil bound (see paper)
30% identity, 23% coverage: 6:102/417 of query aligns to 138:235/240 of 6myrB
- binding fe3-s4 cluster: C161 (= C35), Y171 (≠ L45), P174 (= P48), C208 (= C75), H209 (≠ L76), T210 (= T77), I211 (≠ C78), M212 (≠ R79), N213 (= N80), C214 (= C81)
- binding thiapronil: P162 (= P36), W166 (≠ L40), H209 (≠ L76), I211 (≠ C78)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), A155 (≠ G29), C157 (= C31), A175 (≠ R49), C218 (= C85)
Sites not aligning to the query:
6mypB Avian mitochondrial complex ii with ttfa (thenoyltrifluoroacetone) bound (see paper)
30% identity, 23% coverage: 6:102/417 of query aligns to 138:235/240 of 6mypB
- binding fe3-s4 cluster: C161 (= C35), C208 (= C75), H209 (≠ L76), T210 (= T77), M212 (≠ R79), N213 (= N80), C214 (= C81)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), A155 (≠ G29), C157 (= C31), A175 (≠ R49), C218 (= C85)
- binding 4,4,4-trifluoro-1-thien-2-ylbutane-1,3-dione: P162 (= P36), W166 (≠ L40), H209 (≠ L76)
Sites not aligning to the query:
6myoB Avian mitochondrial complex ii with flutolanyl bound (see paper)
30% identity, 23% coverage: 6:102/417 of query aligns to 138:235/240 of 6myoB
- binding fe3-s4 cluster: C161 (= C35), Y171 (≠ L45), P174 (= P48), C208 (= C75), T210 (= T77), I211 (≠ C78), M212 (≠ R79), N213 (= N80), C214 (= C81)
- binding N-[3-(1-methylethoxy)phenyl]-2-(trifluoromethyl)benzamide: W166 (≠ L40), H209 (≠ L76), I211 (≠ C78)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), A155 (≠ G29), C157 (= C31), A175 (≠ R49), C218 (= C85)
Sites not aligning to the query:
2fbwB Avian respiratory complex ii with carboxin bound (see paper)
30% identity, 23% coverage: 6:102/417 of query aligns to 138:235/240 of 2fbwB
- binding 2-methyl-n-phenyl-5,6-dihydro-1,4-oxathiine-3-carboxamide: P162 (= P36), W166 (≠ L40), H209 (≠ L76)
- binding fe3-s4 cluster: C161 (= C35), Y171 (≠ L45), P174 (= P48), C208 (= C75), T210 (= T77), I211 (≠ C78), M212 (≠ R79), N213 (= N80), C214 (= C81)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), C157 (= C31), A175 (≠ R49), C218 (= C85), P219 (= P86)
Sites not aligning to the query:
8gs8B Cryo-em structure of the human respiratory complex ii (see paper)
30% identity, 23% coverage: 6:102/417 of query aligns to 139:236/239 of 8gs8B
- binding fe3-s4 cluster: C162 (= C35), Y172 (≠ L45), P175 (= P48), C209 (= C75), H210 (≠ L76), T211 (= T77), I212 (≠ C78), M213 (≠ R79), N214 (= N80), C215 (= C81)
- binding iron/sulfur cluster: C152 (= C25), C155 (= C28), C158 (= C31), A176 (vs. gap), C219 (= C85)
- binding ubiquinone-1: P163 (= P36), W167 (≠ L40), I212 (≠ C78)
Sites not aligning to the query:
2wdrB E. Coli succinate:quinone oxidoreductase (sqr) with pentachlorophenol bound (see paper)
29% identity, 20% coverage: 7:90/417 of query aligns to 137:221/238 of 2wdrB
- binding fe3-s4 cluster: C159 (= C35), P172 (= P48), C206 (= C75), S208 (≠ T77), I209 (≠ C78), M210 (≠ R79), N211 (= N80), C212 (= C81)
- binding pentachlorophenol: P160 (= P36), W164 (≠ L40), I209 (≠ C78)
- binding iron/sulfur cluster: C149 (= C25), I150 (≠ V26), L151 (≠ H27), C152 (= C28), C155 (= C31), A173 (≠ R49), C216 (= C85), P217 (= P86)
Sites not aligning to the query:
2wdqB E. Coli succinate:quinone oxidoreductase (sqr) with carboxin bound (see paper)
29% identity, 20% coverage: 7:90/417 of query aligns to 137:221/238 of 2wdqB
- binding 2-methyl-n-phenyl-5,6-dihydro-1,4-oxathiine-3-carboxamide: P160 (= P36), W164 (≠ L40), H207 (≠ L76)
- binding fe3-s4 cluster: C159 (= C35), P172 (= P48), C206 (= C75), H207 (≠ L76), S208 (≠ T77), I209 (≠ C78), M210 (≠ R79), N211 (= N80), C212 (= C81)
- binding iron/sulfur cluster: C149 (= C25), I150 (≠ V26), L151 (≠ H27), C152 (= C28), A153 (≠ G29), C155 (= C31), A173 (≠ R49), C216 (= C85), P217 (= P86)
Sites not aligning to the query:
2aczB Complex ii (succinate dehydrogenase) from e. Coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site (see paper)
29% identity, 20% coverage: 7:90/417 of query aligns to 137:221/238 of 2aczB
- binding 3-[(2s,4s,5r)-5,6-dichloro-2,4-dimethyl-1-oxohexyl]-4-hydroxy-5,6-dimethoxy-2(1h)-pyridinone: P160 (= P36), W164 (≠ L40), H207 (≠ L76), I209 (≠ C78)
- binding fe3-s4 cluster: C159 (= C35), P172 (= P48), C206 (= C75), S208 (≠ T77), M210 (≠ R79), C212 (= C81)
- binding iron/sulfur cluster: C149 (= C25), I150 (≠ V26), C152 (= C28), A153 (≠ G29), C155 (= C31), C216 (= C85), L220 (≠ V89)
Sites not aligning to the query:
1nenB Complex ii (succinate dehydrogenase) from e. Coli with dinitrophenol-17 inhibitor co-crystallized at the ubiquinone binding site (see paper)
29% identity, 20% coverage: 7:90/417 of query aligns to 137:221/238 of 1nenB
- binding calcium ion: D187 (vs. gap), T190 (= T63)
- binding 2-[1-methylhexyl]-4,6-dinitrophenol: P160 (= P36), W164 (≠ L40), I209 (≠ C78)
- binding fe3-s4 cluster: C159 (= C35), P172 (= P48), C206 (= C75), S208 (≠ T77), I209 (≠ C78), M210 (≠ R79), C212 (= C81)
- binding iron/sulfur cluster: C149 (= C25), I150 (≠ V26), L151 (≠ H27), C152 (= C28), A153 (≠ G29), C155 (= C31), C216 (= C85), L220 (≠ V89)
Sites not aligning to the query:
1nekB Complex ii (succinate dehydrogenase) from e. Coli with ubiquinone bound (see paper)
29% identity, 20% coverage: 7:90/417 of query aligns to 137:221/238 of 1nekB
- binding calcium ion: D187 (vs. gap), T190 (= T63)
- binding fe3-s4 cluster: C159 (= C35), P172 (= P48), C206 (= C75), S208 (≠ T77), I209 (≠ C78), M210 (≠ R79), C212 (= C81)
- binding iron/sulfur cluster: C149 (= C25), I150 (≠ V26), C152 (= C28), A153 (≠ G29), C154 (≠ F30), C155 (= C31), A173 (≠ R49), C216 (= C85), L220 (≠ V89)
- binding ubiquinone-2: P160 (= P36), W164 (≠ L40), I209 (≠ C78)
Sites not aligning to the query:
P07014 Succinate dehydrogenase iron-sulfur subunit; EC 1.3.5.1 from Escherichia coli (strain K12) (see paper)
29% identity, 20% coverage: 7:90/417 of query aligns to 137:221/238 of P07014
3sfeB Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and thiabendazole (see paper)
30% identity, 23% coverage: 6:102/417 of query aligns to 138:235/240 of 3sfeB
- binding fe3-s4 cluster: C161 (= C35), Y171 (≠ L45), P174 (= P48), C208 (= C75), T210 (= T77), I211 (≠ C78), M212 (≠ R79), N213 (= N80), C214 (= C81)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), A155 (≠ G29), C157 (= C31), A175 (vs. gap), C218 (= C85), P219 (= P86), K220 (≠ S87), L222 (≠ V89)
- binding 2-(1,3-thiazol-4-yl)-1h-benzimidazole: H209 (≠ L76), I211 (≠ C78)
Sites not aligning to the query:
3sfdB Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and pentachlorophenol (see paper)
30% identity, 23% coverage: 6:102/417 of query aligns to 137:234/239 of 3sfdB
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), T209 (= T77), I210 (≠ C78), M211 (≠ R79), N212 (= N80), C213 (= C81)
- binding pentachlorophenol: P161 (= P36), W165 (≠ L40), I210 (≠ C78)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), A174 (vs. gap), C217 (= C85), P218 (= P86), K219 (≠ S87)
Sites not aligning to the query:
3aegB Crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-iodo-benzamide
30% identity, 23% coverage: 6:102/417 of query aligns to 137:234/239 of 3aegB
- binding N-biphenyl-3-yl-2-iodobenzamide: S162 (≠ T37), W164 (≠ Q39), W165 (≠ L40), H208 (≠ L76)
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), I210 (≠ C78), M211 (≠ R79), C213 (= C81), I227 (≠ V95)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), A174 (vs. gap), C217 (= C85)
Sites not aligning to the query:
Query Sequence
>Ac3H11_3398 FitnessBrowser__acidovorax_3H11:Ac3H11_3398
MQTQLSPEYRARADGLEAESILRKCVHCGFCTATCPTYQLLGDELDGPRGRIYLIKQVLE
GETPTRKTQMHLDRCLTCRNCESTCPSGVQYGHLVDIGRKIVDEKVPRPVGEKALRWALK
EGLPSPLFAPAMKAGQLVRGLLPEALKAKVPAPQDAGAWPTREHARKVLLLAGCVQLAMM
PNINTATARVLDAVGIQTVIAPKAGCCGAVKFHLNDQAGGMAEMRANIDAWWPLVEAGGV
EAIVMNASGCGVTVKEYGHILKDDAQYAAKAERISALTRDLSELLPAMLPELADKLQGRV
NQPDTMYAYHPPCTLQHGQKLRGGVEAHLNQLGFQLSTARNDAHLCCGSAGTYSVLNPDL
SYQLRDRKLGVLAEAFGEQPPDMILSANIGCITHLQSGTGTPVRHWVEVLDEALRGQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory